SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374989821|ref|YP_004965316.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989821|ref|YP_004965316.1|
Domain Number 1 Region: 63-342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.52e-40
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 476-576
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000133
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374989821|ref|YP_004965316.1|
Sequence length 707
Comment serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MDEVPRTDPRMAVLANPEVPERKRFCSRGDCGAPVGRARGDRPGRTEGFCTKCGHPYSFV
PKLSPGDIVHGQYEVAGCLAHGGLGWIYLAIDRAVSDRWVVLKGLLDTGDEEALSVAVSE
RRFLAEIEHSNIVRIYNFVEHLDQRTGSLDGYIVMEYVGGKSLKDIANSRRAPDGRRDPL
PVEQACAYGIEALEALDHLHSRNLLYCDFKVDNAIQQQDQLKLIDMGAVRRMDDEESPIY
GTVGYQAPEVSELGPTVASDLYTVARTLAVLTFDFQGYTNVFADSLPDPGNIEVFQRYES
FYRLLVRATDPDPNRRFGSAQEMADQLTGVLREVVALQTGRPRPALSTLFGPEPRVVDTL
LFAEQGQDASALGARAGRGRAAAAPPRPQGVLALPLPAIAPLDTRATALALPVPLVDPDD
ANAGFLAGLLASAPTELHAALRAAPADSLELRLRRIRAQLELGHAREAGIALDGLEAGHP
DDWRIVWYRGLHALATGDNETAALSFDAVYDAFPGEPAPKLALGVCAEVLGQLDNAAEYY
RLVWTTDPNHVSAAFGLARVLLYAGDRAGAVAALESVPESSIHYTAARVAAVRARLRQRA
AHEPLLADLTAAAQQVERLGHLGLDAVRYERLCTEVLGSALDWVLSGSSGAPPGGARPSL
LSSSLDERGLRFGLERSYRVLARLAQRGEERIELVERANRFRPRTWV
Download sequence
Identical sequences D7C3G0
gi|374989821|ref|YP_004965316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]