SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374989960|ref|YP_004965455.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989960|ref|YP_004965455.1|
Domain Number 1 Region: 38-147,213-286
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000165
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 
Weak hits

Sequence:  gi|374989960|ref|YP_004965455.1|
Domain Number - Region: 166-360
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.0115
Family Prolyl oligopeptidase, N-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374989960|ref|YP_004965455.1|
Sequence length 367
Comment hypothetical protein SBI_07204 [Streptomyces bingchenggensis BCW-1]
Sequence
MTFAARLVTTLATPLDLAVADAPSPQAGPEARLVVQRGDAEVVAYDLDEYAAVGEAAVVR
FPAPWPRRFGTVTVSPRLDLAVFAGVHALRAVDATGAVRWEVRHGCWDGSCRELHTSFDE
YPDSHGHLYADSGSAAVAADGKLVWAHIRGPLASDADPDPGALDEWLVLDAADGKVLARV
DAQTAAAGSEHVPHPDPGQMGLSVGEGQDGVPLLWGRWDGRTLTVDRLGGDDWVLLAVSP
SGNRFLTVTHYQETLAVHRGADGSVLAEADAATAVPRHPEMPPDSDEDEPCWDYYAGFLD
EDTVITGTAGSDEEFGGERHWLLDAARMSVTGQIDYPFAISGWPTALGDGTWLTRSEAGD
ALHLWTL
Download sequence
Identical sequences D7C5D6
gi|374989960|ref|YP_004965455.1| WP_014179774.1.69245 WP_014179774.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]