SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374990455|ref|YP_004965950.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374990455|ref|YP_004965950.1|
Domain Number 1 Region: 107-220
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.16e-21
Family Tetracyclin repressor-like, C-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 35-98
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000116
Family Tetracyclin repressor-like, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374990455|ref|YP_004965950.1|
Sequence length 221
Comment putative regulator [Streptomyces bingchenggensis BCW-1]
Sequence
MTARDGALAAPDGVTAARDGALAARDCAGPRLPGRPRSAAVDAAIIEATLRLIEEGATIG
ELSIEGIAREAGVGKATVYRRWSGKDALLIDVVRSLEEPSRPALGISVRDDLVTILERMR
RRGLAKRSSALLRTVLTQMHANRKLWRAYEDHVIAARREVMYEVLRRAMANGEIRDDLDV
ELIADLFTGPMLSRTILHERKALPEGLAETIVDTVLEGVRT
Download sequence
Identical sequences D7CCX2
gi|374990455|ref|YP_004965950.1| WP_014180269.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]