SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374990844|ref|YP_004966339.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374990844|ref|YP_004966339.1|
Domain Number 1 Region: 14-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-57
Family Protein kinases, catalytic subunit 0.000058
Further Details:      
 
Domain Number 2 Region: 493-618
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.24e-26
Family Quinoprotein alcohol dehydrogenase-like 0.0015
Further Details:      
 
Domain Number 3 Region: 409-495
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000608
Family Quinoprotein alcohol dehydrogenase-like 0.0018
Further Details:      
 
Domain Number 4 Region: 579-702
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000000746
Family Quinohemoprotein amine dehydrogenase B chain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374990844|ref|YP_004966339.1|
Sequence length 731
Comment serine/threonine protein kinase, partial [Streptomyces bingchenggensis BCW-1]
Sequence
MAAFAPLQTGDPERVGRYRIVGRLGRGGMGQVYLGLSPSGRAVAVKVVRAALADDPGFRR
RFAREVAAAREVTGFFTAAVVDADPEGTPAWLATTYIPGMSLEAAVAAHGAWPKRSVMAL
GAALAEALGAVHRSKLVHRDLKPSNVLLAADGPRVIDFGISLAAETTKLTEAGVVIGTPG
FISPEQLVADKVSAASDVFALGAVLAYAATGSGPFGTGPAQALNYRVAHAEPDLTGLPPE
LADVVARCLSKDPDQRPTVPHLVEELGRASRTGRAEGFFTEADWLPEPVAAEIARAQATP
LPRPVEQATAEPAPTAVATAPPLEEAGAVATAPPPASSAAQPPPSESTPGGGKRRLTRRR
ILTGLVVAAVLSLVCTTALLSGLLPGGDGQGDDASSGAPARKEPVRKELWSYALDDQMEL
STVADGRVYLDNGKDSLYALDADSGDELWHQRGTGGSLLLLGASGGMAYYGDDDYMYALD
ADSGDEIWKFKDGGVHLTPVAVGETTYATYSGFLAAVRSDTGKGIWRKKYDGALREGVTI
ADGVLYPVSAGGDDTLYAVDAKSGDDLWEFKAGSEIVSSPVVADGTVYFGSKDGTLYAVD
SDSGREVWRRGFDGKLWDPAVANGAGAPIVADGVVYFENDGYVCAFTADNGKPLWRQKPH
LEDVELLSVVGDTVLFSDGGDGGRTLYSLDAGSGDRVRKEDLGENQTVVDGTLYYENAGR
LHAVSATATDE
Download sequence
Identical sequences D7CI30
gi|374990844|ref|YP_004966339.1| WP_014180658.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]