SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374992247|ref|YP_004967742.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374992247|ref|YP_004967742.1|
Domain Number 1 Region: 41-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-64
Family Protein kinases, catalytic subunit 0.0000612
Further Details:      
 
Domain Number 2 Region: 389-456,510-741
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-18
Family Quinoprotein alcohol dehydrogenase-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374992247|ref|YP_004967742.1|
Sequence length 746
Comment Serine/threonine protein kinase-like protein [Streptomyces bingchenggensis BCW-1]
Sequence
MHTPAHGGGDPTVPQPHTKVFEPHPTVPHPTVPRQQSPGRIGPYEVFQLLGEGGMGRVFL
ARSPGSRLVALKVVRPEYAETPNFRGRFRREADAARRVSGFYTPPVLDADADAPQPWLAT
AYIPAPSLHEVVHRFGVLTEPALRALGTGLAEALLAIHAAGIVHRDLKPGNVLVAEDGPR
VIDFGISRAADATQVTRTDAVIGTPGFMAPEQIVSSREAGPAADVFSLGCVLVFAATGRG
PFGAGNTAEILYRAVHAPPLLDGVPEALRPLAAACLDKDPARRPPTGAVLAALGPAEPSA
LLTPGLRDDLTTREAHAAVLVAAPPMPVTSLTTADRSRPSRRRFVRITVVGGTAAVAAVA
AGAAVVAGRRSEPGRTPGDGGSAGTTVRPGAKVPAGPEPRWSSPLRRVENGQLRLLGSAL
VHWDKQTAIAYDTTTGKELWTAKARIPSDASSGPDWLTVRGSTLFGTAWAGERGYLLGVD
AKGDLKFTHTVTEQKDTGSYADQVQDVLCVTGSVAVVSTSGNQGYSVCAVDLADGSVLWS
RTVNGSDFQAIADGRHCFVQDNGNVHRIELRSGEVRWTVRDVIKPGAYPKLATDGNALLV
THVKVRALSTADGGDLWTAVNETTNLSPTTVQGKRAYVADGQGTVFALDLRHGSQLWHTP
SPLTLDPAGALDPGPSVTESLVALSLFGADTPGFIVLRASDGKPLWAHRASGAEAKNKKS
WSVQASGMTVYAASDTTLYAFRSPTP
Download sequence
Identical sequences D7C7R3
WP_014182058.1.69245 WP_014182058.1.9551 gi|374992247|ref|YP_004967742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]