SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374992423|ref|YP_004967918.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374992423|ref|YP_004967918.1|
Domain Number 1 Region: 141-379
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 7.06e-27
Family Nitrous oxide reductase, N-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 74-160
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000302
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  gi|374992423|ref|YP_004967918.1|
Domain Number - Region: 510-781
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.000126
Family Arylsulfatase 0.089
Further Details:      
 
Domain Number - Region: 346-445
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0183
Family Serum paraoxonase/arylesterase 1, PON1 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374992423|ref|YP_004967918.1|
Sequence length 916
Comment phosphoesterase [Streptomyces bingchenggensis BCW-1]
Sequence
MQVTRRRKLVEEARINLIGRRIGRRIPLLTAGTTAVALVAAGTALAQTHQFGTDQVGQVT
ENGQVVSSNQYIAPYGDRLVINQGKIMSSSVSPDGTHMAASVTDGGAALAIVDLKNWKTQ
QLVSNAASSNPRISSNNVGQEGPTYSPDGKQLWLGQPDGYTVFTVNADGSVSSPRTVSIP
AQGSKHALVGAAAFSADGKTVYSAVNGQNRVVAIDAATGTIKQSWNVGNAPRGMVIVGNK
LYVSNEGGRPAKPGEPTINSYGTQVLADQKTAATTSGTVSVIDLANQDAAVSSIEVGLHP
TAVYAKNGVVFVTNTADNNVSVIDTAKDKVVQTISTQPWAKAQVGYEPDAVTLTDDGHLL
VTLGRANAVAVYKYTSAQEPVSYVGLLPTDYFPSEITTSGNEVYVSNTRGIDARRKATGG
HGTHDTTSSVQKFTLPGDNVIKSYTGKVFKQNGWNGESLKKSDGSPAKPVPVPVKLGDPS
TIKHVFLLVKENRTYDQVFGDIPQGNGDPSLTEFGENVTPNQHALAKQFGLYDNTYDIGT
NSAEGHNWLMQADDPEYTESSAGEYTRSYDTEDDALGHQKTGFIWTGAQAAGKSVRNFGE
FQQFLTKPSGASWQNLYCDSKNMAATGQDTAYPLNSTSPIPSLNDVSVHGFPKFDTSVPD
VYRAQIWKKDFEKNGPANLNMFWLSSDHTGGPVSAASQVADNDLAVGQIVDEISHSKYWK
DSAIFVVEDDSQAGLDHVDGHRAPVQIISPWAKHSTVDSHYYSQITMMRTIEQILGIQPM
NQKDTAATPMASAFTQSPDFTPFKVLPNRTSLTAGVKTAPSCGLDTPAAQDLKAAAVPSP
SVPADMKDVAAQWDQWKPKQRLTGPNAVPDYAPPAQMNHLTWYETHNWAKPYPGEKKIYA
PQDVPGAAIPSAENDG
Download sequence
Identical sequences D7C9S5
gi|374992423|ref|YP_004967918.1| WP_014182234.1.69245 WP_014182234.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]