SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374992519|ref|YP_004968014.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374992519|ref|YP_004968014.1|
Domain Number - Region: 137-170
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000152
Family Protein kinases, catalytic subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374992519|ref|YP_004968014.1|
Sequence length 271
Comment hypothetical protein SBI_09765 [Streptomyces bingchenggensis BCW-1]
Sequence
MLLRLAYLGVTNAFAMLRLLPMTDRDKDAEILALRHQITVLERQLGKDKIRFRPSDRAFL
AALLHRPAGSDRTSRLMTTYTVRSTRTPARRSAKAPPSGPRPRPRGEGSRVRSYLIAVVK
PRHHQGHRREARHHRTATGLLIGTPAYMGPERFSGTFDHAPAVYSLGCTAATGGIDTLLD
AGAPSAPAAYPREQHPPAVPAMLIFFRSCFFGTRLPIHGGISVAISRPRAANAMNRQGFS
VRRAGSLRMPASTTVRWVRPGRRSSGHARGH
Download sequence
Identical sequences D7CBK6
gi|374992519|ref|YP_004968014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]