SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374983650|ref|YP_004959145.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374983650|ref|YP_004959145.1|
Domain Number 1 Region: 20-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-54
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 541-732
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.18e-16
Family Quinoprotein alcohol dehydrogenase-like 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|374983650|ref|YP_004959145.1|
Domain Number - Region: 482-537
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000392
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374983650|ref|YP_004959145.1|
Sequence length 746
Comment serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MAMTENPIVAPLADDDPMRLGPYRLLGVVGAGGMGKVYLGVDAAGRTAAVKALRAADDVD
PGMLDRFRREAEVARSVRGPGVAAVLGHGVWAERPWLASEFLPGLTLTRAVERFGPCAEA
DVRALGAALAGTLAEIHAAGLVHRDLKPSNVVLTRGGPYVIDFGIARPEHGMTLTGAGSA
PATPGFSAPEQVLGRRTGPPGDVFALGAVLAFAATGRLPFGDGHPAAVQFRTVHEQPDLE
GVPRALRGVVTDCLTKEPAQRPEPREVARRLHTERGTERGTERGAEHGAEQGTEHATERS
GKPGTARRTGWLAAHRPRLAQPLRPPLRPRRPAWRSGPLAAELARCAAAVDDTVRSAAPE
AAPSRRRVTAGGRLRCRGHRLRRGRRGGVVAAAWRPPRPRRPRRHPARPVHDGHRARSAV
DPRRPRHQRRRPARGRRGRGRRNAQGPDRMGRGHRAASVDLDRPGHAAARRGSAGGGRGR
AGGAVLAVTTGGRLTAVDARDGRERWSRAVGATRLLAADADTAYVLDGERRLNALPLTGA
RARWTTPAATGTAKGAAAAAAGGRLVVAGSDGTVTAYRTDDHGSVAWHQDTAADVALAPA
VAGDTVYLGGASLRALTLADGTRRWARPTPGGGAWGSPTSAQGSLYVAWQDQLIAVDARS
GEQTWSLLPGTHALPTTAPVVQGRSLYHPLGADRFGPDDGVVTVDLRKAAAAWSLGGGGD
QPWRLTGAANRVFLTHAGTLHAMPVL
Download sequence
Identical sequences D7C626
WP_014173493.1.69245 gi|374983650|ref|YP_004959145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]