SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374989109|ref|YP_004964604.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989109|ref|YP_004964604.1|
Domain Number 1 Region: 162-426
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-38
Family Protein kinases, catalytic subunit 0.00044
Further Details:      
 
Domain Number 2 Region: 519-649
Classification Level Classification E-value
Superfamily TPR-like 0.0000000232
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374989109|ref|YP_004964604.1|
Sequence length 785
Comment protein kinase family protein [Streptomyces bingchenggensis BCW-1]
Sequence
MTDGTSGGAAVCDRPDCPGAGRGRINVRGFCSECGRKARGRAVGSPSPDTPAPAPASAPA
SASASASAILESESTATAARARRRAVARKFTVRPAGDGLMDLPRVELPSLRDLVIDDPQP
PPQGQPCAGCEVTVGAAYAGQPALWTGVCHRCRHPFDFTPQLRPGDLLGGQYEVIGGVAY
GGLGWVYLAEDTQLDRQPVAIKGLINDDDETAQRAAIEERRYLTMLDHPGIVSIINYVRH
PARGSGRPQGYIVMEFVAGVTLSTIGDYIARVDPHFDGPRVYQHILTYGALALDALEYLH
GEKLVYCDLKPSNVMHHEGRVKVIDLGAVRQLGQRDGRPVITEKFAAPEVVHHGALPTEL
HDLYGVGKTLKNLSDKVRRAAQRPPGLGRESYDRLLARATAYDPRQRFGSAREMAEQLRG
VLREIHSLRLEREQPEPSTLFAPTAALLDSGLGRIPGLERWLTGQARPVLADGRPGPKRV
PLGLPVPFPDAKDPGAALLNTPTDSGPRRLIEQLRAFPHESAEIRFRICRAHLELDEVDE
AKAQVKAVERIIGGDRAPYEWRLNWHRALVRLAEGAVAEARREFDAVYGALPGEYAPKLA
LGYCAEHLADHDAAERFYQAVWQRNRSQGSAAFGLARLRLAAGDRTGAVDVLSEVPKVSR
HHDAAQIATVRVLAGRLGHPDGLPTEADFAEVLTRLPRLYLDDGRSSGHARERLTAEVWE
VALDWVLRYGNKEEAGALFGKRDEEAVVRADLERALRDLAQQADRPEAVEVLVDRANAVR
PMTRV
Download sequence
Identical sequences D7BSF5
WP_014178924.1.69245 WP_014178924.1.9551 gi|374989109|ref|YP_004964604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]