SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374992295|ref|YP_004967790.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374992295|ref|YP_004967790.1|
Domain Number 1 Region: 8-302
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-71
Family Protein kinases, catalytic subunit 0.00000254
Further Details:      
 
Domain Number 2 Region: 406-598
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.19e-22
Family Quinoprotein alcohol dehydrogenase-like 0.0085
Further Details:      
 
Domain Number 3 Region: 544-763
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000102
Family Quinoprotein alcohol dehydrogenase-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374992295|ref|YP_004967790.1|
Sequence length 766
Comment WD40-like serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MHDRDLILADRYRLVRPLGRGGMGEVWEARDASLRRPVAVKVISILAGGGSRADEARARF
LREARITAALQHPHIVTVHDLGEATTDQGTTPFLVMELLRGEGLDAVVRRGPVSEEEVAR
WGAQVCDALGAAHAAGILHRDIKPANLFVAASGSLKVLDFGIARAADASATGDRLTHTGF
MVGTAAYMAPEQARGRPEQRSDLYSLGCVLFELLTGRLPFDAPDTLGYVTAHLHDPPPAP
SSLVPGVSAPWDRLVGRLLAKDPRERYESAAVLADELRRFDGVRQAAPAVRYTPTVADQE
HVADQEHRSSSPPSAASVSGDLAAASTVQAPVGPFGGTGMSRRSLLLGGAGVAAVAVAGG
AAAMYLTGDPKRDPVAWSQKIADVDLINSDGPDVVLADGRCHVAAGHYYKETAALHTFDL
ATGKRLWKTSFNAAWSRETRFTVVGGTLLALTRYSDNKGGQVRAFDAATGERRWQHSVSN
SAMGLEVHRPSGLLITGEDGHVIGIDPRTGNQRWATDVSSPYDATWILAGDLILCSGGTA
VLGKTGKKLWTRSGFQPQGDLAQPLGEGLLCYEDGRTVPVDLVCRKADTGEVMWRSPFQK
TEPDTLTTGAFQPLDELVSGTTVFLPLAAGPRRKPTALNGLTGEQIWTYGSTYQEVGLKE
QATTSVAGGFVLPTGSGPVCVAAADGTKRWHADTQRVQTTGKYALLSGTEQARVFQRWTS
VRIVGVEHGRTLWTGQFDSTAMSEPAASGDAIVFLDGGGTVWAVRV
Download sequence
Identical sequences D7C9E7
WP_014182106.1.69245 gi|374992295|ref|YP_004967790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]