SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374992654|ref|YP_004968149.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374992654|ref|YP_004968149.1|
Domain Number 1 Region: 288-568
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.86e-49
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 
Weak hits

Sequence:  gi|374992654|ref|YP_004968149.1|
Domain Number - Region: 21-87
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000104
Family FHA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374992654|ref|YP_004968149.1|
Sequence length 726
Comment putative serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MSGVVVHLPQGSGADGGEPVTLRLGPGEVARFGRGSPTTPVELRLDDDAVSRLAGEIRVT
DDHWQLTNHSTSHSYLVENPEGAGEYLRVQPRRVGAPIPFEFSRVVLPTRSQVPVVFQVF
APDHVYLDPDATGVLWGSRTVMAYSLDETATYFLVLVALCEPRLRDQSRVAVPTTPQIVE
RLNGHTTSGALTARAISSHIDYLAEQKLRIGPPDVHDPGKGDRRNGKREEIVGLALRFGL
VREEHLALLPPPTGAAGRERQAARGAMTPLHGPGGTTGEPADLLPSGYRAGEWAVSELIG
VGGWSTVYAARPSGRTGGPARPAEVALKVMPTAGLAPRQARRIVESAHREVELGRRTGHP
RLIGLIESFVLRAPDRPSLDGAIVLVMERAARSLRELLDAGVPEADRGRLIEGICEGLAH
LHRSGWVHADLKPENVLLGRDGSVKLSDFGLATELTGTHGYAPPLGTLDYLPPERWKAPL
GALGVQVRPSADIWALGIVIHEVFASGTSPFAGATPVARGAAVQEYGEGRAPLRMDHAVP
PFWRDLAADCLAPTHEARAEHTADSLLGRIAAGQPTRRSRGARPHGRARTALLAVALCAT
AGATLSGEAPRKEAFRPTGELTVFNAERRCQDRTDRDLHCSLGLAIDPTRPYTPGNVVPT
RVWHGDVLTAECQLPHGLPIVDEDDLRSTRWFRVRLPSGSAPAGWLPAVRTKDRPPLPNC
PYPTAP
Download sequence
Identical sequences D7CDH6
gi|374992654|ref|YP_004968149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]