SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspgl1|67618|fgenesh1_pm.14_#_114 from Aspergillus glaucus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspgl1|67618|fgenesh1_pm.14_#_114
Domain Number 1 Region: 1185-1302
Classification Level Classification E-value
Superfamily PH domain-like 3.96e-21
Family Ran-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspgl1|67618|fgenesh1_pm.14_#_114
Sequence length 1303
Sequence
MSSTPEEKPQRASAAQLANRKIRDVRRRRPGTAAPSPTPPPQQQQQQQQQPFNSPFGSLN
QNANPPAPTNGFSFGQSQSFPGPAPTTSQPGTNGTSSPFSFGGGSGGPSFNFAAGATTTA
SNPFATVSTAAPSQPADGGSFGGFKGNIFNLAPASPAPSGGLFGATSGPSAGATPATSGA
GLFGQTSASSPAPTPAASTSIFGQSTSDKPSIFGQSTGSADDSMQTSPDAKSSTASKPSI
FGNGTTPAPPPTFGGFGGDNLFSKPASSAPSPSPTKPLFGAKPDEKSTPAIPFTFGAKPA
EQSGVASPSIFGATTQTSSATTTPTTAPSLFGASTSQNPFQSGNLFSGAPAATEKPQEEK
KPSDSAPKSPFQFTPSASTGPSLFSKSETAPAPAASGGSFGQNPSLGASQPPSTGNIFAP
KPPTSTEEKAPAANPFGGIFAPKPASESKPEEGKQQPAAQPSFGGGLFSPKPSEPAEPTT
STPSFSASTPAAGTAKPPSAFQPSTSLFQPPPAAAPRPASQRLETMQPKGLSVDLNKHLQ
DDVELLNRVRILNESFKREITKLDPSKDDFDLVILYYMRVRDTIGAPTGGEHAPKRKTRD
EDGDQGVPAQKKAKPFGEAASSSAPQMNIAPSSITSTSSNLFGASEIAKPSPSKRKVDDE
DGSVSEPPSAKRSQGDSTTASIFAQTFSNSKSAESDKEEPFQSPVSSPFKPSTPESKKVA
PVSTTPTTSPAKTLFPTPAASNEPSAPTSLFGQPSSASKPASEAPNTDAAPANPFTLKPT
ENKSAELAAAPSFSMPKFGGGGGTNFFAQFKTQAESHAEKEKAKRKEEDFDSEEEDEAEW
ERKDAEKQRKKREELEAQSQRRAKFIPGQGFSFDEDGSTNTQDSKKSDETNGVSFASSAT
SVFDTKSETEEKPSNIFSHLSATPTEVEENDGDVTEEASDNEDEGPGSKAATVSKDDGSN
DSEDGDFGKALKKSKAADKPATATETTSESTPAKPAGGSLFGSVQDKEGEATPKNPFGSL
FSTPKPQASSSGTPSLFAPTTSTSGSTSLFGASTNATGGSLFGASTVGTGSLFGAGQNGV
KNDQTWKKDSPIKFASDSSSTSKPDTSSSEAPKPFSTLFGAGGAPKPTSGDSKPSLGFTF
GAPSTQTSSIFSSAANSAATSAASTPGTSDAGAGESGDGEAAEALPQVNLARGGAGEENE
EVLMETRARGLKMAKEGWDSQGVGFVKILKNRETSRSRVVLRADPSGKVLLNASLMKAIK
YTINGTGVLFAVPQPDGSLEQWAIRTKKEDIGRLGSTMEEAKA
Download sequence
Identical sequences A0A1L9VFT0
jgi|Aspgl1|67618|fgenesh1_pm.14_#_114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]