SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC23561 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC23561
Domain Number 1 Region: 78-143
Classification Level Classification E-value
Superfamily mu transposase, C-terminal domain 0.0000732
Family mu transposase, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC23561
Sequence length 273
Comment pep supercontig:GCA_001187945.1:JRES01001336:1775:2665:1 gene:FF38_07072 transcript:KNC23561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGGSVADRGANPESEAVWTVDELQILLDLWVLTTWQTKPQSGLRLPDIPRRTLSPNQMY
QALSVAAPQVPVGLSEADYIALMPMEWRTIQPYGINLHSLTYDSEMLHPFRGRTSGLSGA
ARGRWEVRYDPYNLRQIWVRDHHADRWITANWTLSTMTDQPLSREVLHAARANLASDDVR
AASSIDLLKEEAKRAREENSPGTRASSCGRPGRVGFHLICGATHGRALNAGDVATVRRPL
PYPTGHVDGSADVAAVGRGSRRVRRCASAVDGR
Download sequence
Identical sequences A0A0L0BU66
KNC23561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]