SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC30696 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC30696
Domain Number 1 Region: 24-127
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000000249
Family Insect pheromone/odorant-binding proteins 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC30696
Sequence length 136
Comment pep supercontig:GCA_001187945.1:JRES01000501:1268626:1269286:-1 gene:FF38_11678 transcript:KNC30696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKIILLIFCGIYMAKCAEHPSWYPENVNEIKKRCAEENNLTPDFGNILTYEQLANNTNV
HAAYLCAAKGFHFYSDDEGLNVDRMIYFFFKTSTKCIRRKAKECVETHKEVISIGEMIFK
LHYCILELFKAPETEN
Download sequence
Identical sequences A0A0L0CEL8
KNC30696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]