SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC31545 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC31545
Domain Number 1 Region: 25-83
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000068
Family Tachycitin 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KNC31545
Sequence length 88
Comment pep supercontig:GCA_001187945.1:JRES01000409:1733632:1740193:1 gene:FF38_12779 transcript:KNC31545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKQGSIKKNYSEHSGEPGCATAGEVKKFFRHFWDPTSYWECEEQGKPAALRRCGASELY
SDKHGKCVHYREWEWTEPIEPPSRPKTQ
Download sequence
Identical sequences A0A0L0CH22
KNC31545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]