SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC21654 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC21654
Domain Number 1 Region: 403-734
Classification Level Classification E-value
Superfamily L domain-like 3.33e-50
Family Ngr ectodomain-like 0.078
Further Details:      
 
Domain Number 2 Region: 106-441
Classification Level Classification E-value
Superfamily L domain-like 3.29e-42
Family Ngr ectodomain-like 0.033
Further Details:      
 
Domain Number 3 Region: 822-986
Classification Level Classification E-value
Superfamily L domain-like 2.96e-28
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 4 Region: 1085-1225
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.75e-22
Family Toll/Interleukin receptor TIR domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC21654
Sequence length 1468
Comment pep supercontig:GCA_001187945.1:JRES01001589:1804476:1808882:-1 gene:FF38_09781 transcript:KNC21654 gene_biotype:protein_coding transcript_biotype:protein_coding description:Protein toll [Source:INSDC protein ID;Acc:KNC21654.1]
Sequence
MLKFMKMHLRQLQQQHLAFHHLWSYLIVLLFLQFGYYTVKATNLAQVAALATATSIQQQL
ATTQPASTNQCSWQYNGTTSVKCNLRLIERSLALDLQGADGFSQLEIKCSDLYLFESQLP
QAAFARLQTLDELKLVSCKLLQLPNNAFEGLNTVKTLSINTHNSEWGPSKTLELFPDSLN
GLKQLTELELADNNLRALPLGFLCPVGNLQILNLTHNRIRAAENLGFADMNCNGGSELQI
LDASFNELRSITESWGISRLRRLQHLNLQHNNISELSGEALAGLSSLRIVNLSNNHLETL
PEGLFAGSKELREIHLKNNELYELPKGLFHRLEQLLVVDLSGNQLTSNHIDNTTFAGLIR
LIELNLAHNALTRIDYRTFKELYFLQNLNLRNNSIGHIEENSFLPLYNLHTLNLAENRLH
TLDDKLFNGLYVLSKLTLNNNLISVIEPNIFKNCSDLKELDLSSNQLNEVPKAIQDLSML
RTLDLGENQIRTIDNDSFKNLHQLTGLRLIDNQIGNVSVGMFADLSRLSVLNLAKNRIQS
IERGSFDKNYELEAIRLDRNFLSDINGVFATLMSLLWLNLSENHLVWFDYAFIPSNLKWL
DIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFINNNLINTIHPN
TFVDKVNLARVDLYANAMSKLQLQQLRVAPVGPLKQLPEFYLGGNPFECDCTMDWLQRIN
NLTTRQHPRVMDLANIECVMPHARGAPVRSLGTLKPQDFLCRYDSHCFALCHCCDFDACD
CEMTCPNNCTCYHDQIWSTNVVDCGGQQTMELPRRVPMDSSVVYLDGNNFPVLKNHAFIG
RKNLKSLYVNASRVASIQNRTFAGLISLQVLHLEDNLMQTLQGYEFEHLSALKELYLHNN
LLTSIENATLAPLQSLEVLRLDGNRLVTLPIWQLQLPQFKALRSIALGRNHWSCRCKFLQ
ELTSYVADNAVIVQDSQDIYCMEETSGIYASTLGSASGGVGSLATGNRKRELDFNVTAAC
SDYYAGGSMLQHGIPKTYIPLLAAALALVFLLIVVIIIFVFRESLRIWLFAHYGVRVFGP
RCEESEKLYDAILLHSAKDSEFVSQYLVAELETGRPPLRICLQHRDLSHDATHYQILEAS
RVSRRVVILLTRNFLQTEWSRCELRRALHDALRGRPQKLVVIEEPEAVFEAENDIELLPY
LKTSAVQRIRRSDRHFWEKLRYALPVDYRTGNNYTLDHNHERIKQPASPGILYRPAPPPA
YCPEGEGEQNYSSATTATPSPRPQRRGEQHTSTLHHPSNSSHLHPNAVQQAVPQYYHHQA
VTTAGYVQRPPSEHIYSSIDSDYSTLDNEQMLMMPPAPPSPSAVNAGVAINSLHRNIHPH
QLQQQQQHQQQQQHLANMSQTWRPQANQKQRALSAIDPQLQHPGAAQTLQPQATAHPNGP
SSSSSSSSNNQTIQPGQQQGPHVQAYLV
Download sequence
Identical sequences A0A0L0BQY6
KNC21654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]