SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC21670 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC21670
Domain Number 1 Region: 392-576
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.62e-45
Family CRAL/TRIO domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1279-1461
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.83e-43
Family CRAL/TRIO domain 0.0000863
Further Details:      
 
Domain Number 3 Region: 979-1160
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.88e-43
Family CRAL/TRIO domain 0.0000912
Further Details:      
 
Domain Number 4 Region: 686-869
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-41
Family CRAL/TRIO domain 0.00015
Further Details:      
 
Domain Number 5 Region: 1890-2072
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 9.03e-39
Family CRAL/TRIO domain 0.00014
Further Details:      
 
Domain Number 6 Region: 2416-2597
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.84e-38
Family CRAL/TRIO domain 0.0000732
Further Details:      
 
Domain Number 7 Region: 103-284
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.84e-36
Family CRAL/TRIO domain 0.00031
Further Details:      
 
Domain Number 8 Region: 1607-1775
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.37e-36
Family CRAL/TRIO domain 0.00019
Further Details:      
 
Domain Number 9 Region: 2181-2353
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.19e-35
Family CRAL/TRIO domain 0.0002
Further Details:      
 
Domain Number 10 Region: 310-382
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.96e-17
Family CRAL/TRIO N-terminal domain 0.005
Further Details:      
 
Domain Number 11 Region: 897-972
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 5.62e-17
Family CRAL/TRIO N-terminal domain 0.0068
Further Details:      
 
Domain Number 12 Region: 1198-1271
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 3.14e-16
Family CRAL/TRIO N-terminal domain 0.0076
Further Details:      
 
Domain Number 13 Region: 2092-2164
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 5.36e-16
Family CRAL/TRIO N-terminal domain 0.0063
Further Details:      
 
Domain Number 14 Region: 606-676
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000000288
Family CRAL/TRIO N-terminal domain 0.0045
Further Details:      
 
Domain Number 15 Region: 20-94
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000000301
Family CRAL/TRIO N-terminal domain 0.0041
Further Details:      
 
Domain Number 16 Region: 1807-1880
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000144
Family CRAL/TRIO N-terminal domain 0.0077
Further Details:      
 
Domain Number 17 Region: 1509-1585
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000000000102
Family CRAL/TRIO N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC21670
Sequence length 2637
Comment pep supercontig:GCA_001187945.1:JRES01001589:2544206:2574668:1 gene:FF38_09800 transcript:KNC21670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPANADTPPVIRPLTPALQEVAIRELNENPKQLADDVLRLRQWILSQPHLKARTNDQFL
LAFLRGTKFSLERSKQKIDRYYTLKAAIPEVFNDKRVVDDPQVLEILRMGIILQIPIPED
EGRPCVTIIRATAYDTSKYKFEDIIRVGSMFGEIMMIEDDNSTVCGYMEIMDMVDVSGTH
LFNLQPDLLKKFSVFADEAMPMRQKGTCFINVPGPFEKGFNTLKGFFPEKMKSRISVCST
ADIIYDHVPREYLPEEYGGTNGTMQDIIDRMEAKLMKYRDYFLDEPNYGTEEKLREDGLP
FDYESYFALQKVAIEELNEDPKRIESDLADFKAWIEQQPHLKARTTDQFLIAFLRGCKYS
LEKAKLKLDNYYALKEKYPDFLKRPNLDDEKFRKLLKMGIILYLPTPLTESGPRVVLVRN
GSFDPSEFSFSEVAQYRQLMQDITLVEDDVAVVGGLVFIMDFADVSAAHLFQASPGAMRK
VSQYSEQAIPLRIKASHFIDTPSGFEPVFNLIKPIMPEKIQKRMFVHGSKREELFKIIPK
EILPKEYGGLNGSLQDLIDKWEEKILSYRDYFKEDEQYGVDESLRIKEVEVTDTKSTDMG
LVGSFPNEELNEEPQSMASKLQSLKIWITEQPHLKSRTDDQFLIAFLRNCKYNLEEAQQK
LDNYYSYIEKNPEILRRPDVAEERFRKLLKCGVVVYLPQPLNDVGPRVVLVRNGAFDPRE
FSFNEVSQFRQLMQDILFLEDDVAVVSGLIYVMDFGEVSASHYIQVSPAALKKISQYTEE
CVPLNLKVNHFINTATGFAPLYNLAKAFMPAKIQNKMFVHGSDLEQLYKSIPQEILPLEY
GGKAGSLQDLIDQWEQKVLSYVEYFKDNDKYGVDESLRVKNSDGATRSKPLNETLQKAAV
EQLGEDPKRLVEDLEALKTWIKQQPHLKANTDDQFLIAFLRGCKYSLEKAKSKIDKFFTL
KTKFPEMFGVTDIDSPRFKEIFKMGMWMYLPTPLNETGPRICIMRSGLYPADKYSVEEIM
GVANAVQEVLMLDDDYANVNGVVFIGDFEKATMAHMFQMTPGVMKKMTVFSEEAIPLRPK
SSHFFNTPTGFDTVFNMVKPMLSQKQQNRLYVHGNKLDSLTQQIPLKYLPKEYGGENGSF
DEITTVWEKKLEDYRDYFKKNAEYGTDEKLRPGKAIDFDMLIVGSKMAQIRPLNEDLQKA
AAEIGEDPARISADLEALKTWIKQQPHLRANTDDQLLIAFLRGCKYSLERAKSKIDKFYT
LKTKFPEIFRPTDVDDPKFRDIFRLGMWSYLPTPLNGNGPRIGIMRMGLYSADKYSIEEV
MAVASAMQEIVLLEDDYAIINGVVFIGDFEKATMAHMFQMTPSVAKKMTVFSEEAIPLRP
KASHFINTPTGFEPVFNMIKPMMSEKQQKRLYVHGNKMDLLTNEIPLKYLPKEYGGENGC
IADLTVEWEKKLDDYRDYFKKNAEFGTDEKLRPGKAIDFDSMFGIEGSFRKLNAQSIMSY
IKALPLVLQKVAELELAEVPQRIPEDLKALRTWIEQQPHLNARLEEQFLIQYLRGCKYSL
EKAKTKLDLFFTLKSKFPDLFNVTDINETRFRKIYINGFGLALPRPLNEHGPRIFFLTFE
GDIGKGLFDIEDLFRVVNAMHEILIVDDPYAGINGIVYILDMKNISLNMASKFTPSFLRK
IVQFFEKSLPLRIKACHMLNTPGYFHSVLSILMPLLTEKLRQRMFIYGQNYADDLEKNIP
KKYLPNYLGGTNGDREQLIKDFEEKWLEYADYFKQNENYGTEEQLRPGKPIDFDNMYGLG
GSFQELQKVAETELSEVPKRIPDDLLALKTWLQQQPHLKARQDDQFLIQYLRGCKYSLEK
AKTKLDLFFTLKTKFPEFLNVTNVHDPSFRKMYNYGLCGPLPRPLNDNGARIYYTKYEGD
VAKGLVDFDELYRVTNAMHEIVIMDDPYACINGNIYIMDLKGITLNAASKYTPTFLRKLI
QFYEKSLPLRIKGVHFINTPGFFHSVLNIVMPLLSEKLRQRISVNGQNYENLYKIVPKKY
LPQHLGGENGSMDEIFKEFDKKWLEYENYFKDNINYGTNEKLRPGKPIDFDKTELGELTR
RIPDDLQILKTWIEQQPHLKARLDDQFLIQFLRGCKYSLEKAKNKLDLFFTLKSKFPDFF
NITDINEPIFRKMYSYGLGIPLPRPLNDSGPRIFFMKFEGDVAKGLVDFDELYRPTNAMH
EILIMDDPYACINGIIYIMDLKDITLNMAAKYTPSFLLKVVQFYEKSSPLRIKGAHLINT
PTFFHSVLSLVMPLFSEKLRERISINGQNYENLYKIIPQEYFPSHLGGKNGSIADLFNDF
EHKWTEYENYFKENINYGTNEQLRPGKPLDIDSMFGMGGSFRKLDAKIKIDRFYTLKTKY
PDFYTIHNMEKTKIRELVELGIGLSLPMPLNGTGPRILYIRTGHYPTDKFSFADVMCVAN
ALQELCMRDDDYCVVCGYVQILDMSEYSAAHMLQMTPTVVKKMSIFAEDAIPLRQRAIHI
INMPSSYEKVFNMLKPLMPLKQQERMFAHGSNLSSLYEHIPQKYLPQELGGENGSIEELT
KEIKENFSKQQDYFLDDHNYRVEEKLRVDKIINYDDVFGIEGTFRKLNINANLKLTP
Download sequence
Identical sequences A0A0L0BNK0
KNC21670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]