SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC21679 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC21679
Domain Number 1 Region: 112-160
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000166
Family Ovomucoid domain III-like 0.017
Further Details:      
 
Domain Number 2 Region: 204-254
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000527
Family Ovomucoid domain III-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC21679
Sequence length 467
Comment pep supercontig:GCA_001187945.1:JRES01001589:2432063:2433720:-1 gene:FF38_09792 transcript:KNC21679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFFGCCLILSFLSFSKAYTNYKSYPKDYLRNYPKAYPGDYPSDYKSDYPSDYCILGNTP
VCATNGHEYFLLENECEFNNFNSKQLEKGQLDSCYTPASALSYEQHKYDNYCPQYCNRIL
KPLCASYRNEQRNFTNECVLKKHICETKENWQVILNDTCVSVSCALDGQEICASLNGYMQ
SFPNLFSLYGEIQTRGKDWQILNVGPCPCPEDYRPICAQLNCTARTFTNECFLEREVKNG
SHWSILFFGECPELPTSTASPNNVDNNDDEVENSGDGPFDVDDAIAKSLNEECKPRQNKP
VYIVKKNQISPYIPSLYPNKPLGKPHDYHHQNQPYNIAKSNKNTYEKLSKKTYDKYEKAH
VPPKTSYNDHDADMFSNTIYNYAGHVNPPDYQSFFKPLNTPLTVSAVSLVSSGYNNDLYT
AQTVTDIKYQNYNPVSITAYSPAPINSYGDINYNDEDLYDSLYESFT
Download sequence
Identical sequences A0A0L0BR14
KNC21679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]