SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC23614 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC23614
Domain Number 1 Region: 97-396
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4e-31
Family NodB-like polysaccharide deacetylase 0.02
Further Details:      
 
Domain Number 2 Region: 26-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 1.15e-16
Family Tachycitin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KNC23614
Sequence length 487
Comment pep supercontig:GCA_001187945.1:JRES01001325:34842:95916:-1 gene:FF38_00958 transcript:KNC23614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSIKIFTILLVVGSIATAQKEEFQCPSQVANGNYADPVTCRRFYQCVDGYPYLNRCPS
GLYFDDLQKYCTFKDEAKCGPLATTPATITEAPADKAQKCNTEECQLPYCYCSKDGTQIP
GGLEADKVPQIIMLTFDGAVNLNNYDHYNKIFNGKRKNPNGCNIRGTFFMSHEYSNYQQI
QHLGYAGHEIATESISQQQGLQDKGYEEWVGEMIGMREILRHFANVSVNDVVGMRAPFLK
PGRNTQYKVLEDFGYIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSKTFPGVWEVP
LNTHYVEGFEGGHCPYLDQCVLHNLDENEVFEWLQEDFSRYYEQNKAPYMMPFHTNWFQT
KPLENGLHKFLDWALELPDVYVLTITQMLQYMTDPKELREVNTIESWKCDKSVAVAPKPC
NIWNTCALSFKIPEQNITDTRYMETCRECPNVYPWLGDAAGTGIQGRDSYIFSGPVQEAD
GESVDEN
Download sequence
Identical sequences A0A0L0BWH4
KNC23614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]