SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC24757 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC24757
Domain Number 1 Region: 123-202
Classification Level Classification E-value
Superfamily WWE domain 8.24e-23
Family WWE domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 41-125
Classification Level Classification E-value
Superfamily WWE domain 1.44e-22
Family WWE domain 0.0000142
Further Details:      
 
Domain Number 3 Region: 561-649
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000263
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KNC24757
Sequence length 763
Comment pep supercontig:GCA_001187945.1:JRES01001179:134038:138623:1 gene:FF38_04856 transcript:KNC24757 gene_biotype:protein_coding transcript_biotype:protein_coding description:Protein deltex [Source:INSDC protein ID;Acc:KNC24757.1]
Sequence
MAHVNSGAISAGGGGGAGVGATGVGGSGVGGAGISTNVNTHAVVVWEFESRGGKWLPYTP
AVSQHLERAHAKKLTRVLLSDADPELDKYYVNVRTMTQETEDASSRSMAGVRRMFYTPTS
PAGKGTKWEWAGSASGDWHPYNMHVQCIIEDAWSKGEQTLDLYGTSSLPYTINFCNLTQT
RQPSGPIRSIRRTQQAPYPLVKLTPQQAQQLSVQTNYSEYGHKRNNTLPKLAAKAHNNDN
NNKQQQQQQHQTHLQRLNNNAAFGLNNNSSSRQPQSLPHSHSHTHSHSHQQQQQHSIQHP
ITVQQPPQNNRKSTKRNGELSTANLRQILNNLNIFGSSSSKQQQHHHHHQQPTTTNASSS
GSNHLQTQTNHLQPFSHSSNVLTSSMSSHHSRCSEGSLQSKRSSRMSMHRSRSRTRASDT
DTNSMKSHRRPSVDTVSTYLSHESKESLRSRNFAISVNDLLDCSLGSDEVFVPSLPASST
MSSISSSSSMMTAERAPAPPPLPSAGSISVAASGTSSSQHSAATQQQQQQQQHQLQQQQP
IAGSIVGVDPASDMISRFVKVVEPPVWPNAQPCPMCMEELIHNAQNPAIALSRCQHLMHL
QCLNGMIIAQQNDLNKNLFIECPVCGIVYGEKIGNQPNGTMSWSILSKSLPGHEGQNTIQ
IIYDIASGIQNQEHPHPGRAFFAVGFPRVCYLPDCPLGRKVLRFLKIAFDRRLLFSIGRS
VTTGREDVVIWNSVDHKTQFNMFPDPTYLQRCMQQLVHLGVTD
Download sequence
Identical sequences A0A0L0BXJ7
KNC24757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]