SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC25503 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC25503
Domain Number 1 Region: 218-298
Classification Level Classification E-value
Superfamily Homeodomain-like 9.84e-19
Family Homeodomain 0.0000678
Further Details:      
 
Domain Number 2 Region: 79-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000383
Family LIM domain 0.021
Further Details:      
 
Domain Number 3 Region: 47-77
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000143
Family LIM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC25503
Sequence length 448
Comment pep supercontig:GCA_001187945.1:JRES01001109:201177:243146:1 gene:FF38_05159 transcript:KNC25503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAEIGGHLAHQLPLHNHNQTGLQPSLVMNHHLDLDCHGHDVIKKQRLSLCVGCGGQIH
DQYILRVAPDLEWHAACLKCQECRQFLDESCTCFVRDGKTYCKRDYVRLFGTKCDKCGNS
FSKNDFVMRAKTKIFHIECFRCSACARQLLPGDEFALRDGGILYCKEDHDVLEKSSQSSL
TSSSLESNNNNSCSNNNNHSSLSNNNHSSELGSMSDSGSESGSHKSIREKRPSGPSDGKP
TRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKTI
QMKLQMQQEKEGRKLGYGAMQGIPMIASSPVRHDSPLNLQGIDVQTYQPPWKALSDFALH
ADLDSNGAINTHTPAFQQLVNQMHGYDLNGMPPLQPHQQGPHPPPPGQQMNGPPGGSMDS
GITSHHHPDSTDSYVTYLESEDSMPGSP
Download sequence
Identical sequences A0A0L0BZR6
KNC25503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]