SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC26297 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC26297
Domain Number 1 Region: 594-781
Classification Level Classification E-value
Superfamily NTF2-like 8.99e-34
Family NTF2-like 0.00095
Further Details:      
 
Domain Number 2 Region: 440-589
Classification Level Classification E-value
Superfamily L domain-like 4.76e-18
Family mRNA export factor tap 0.004
Further Details:      
 
Domain Number 3 Region: 797-849
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000255
Family TAP-C domain-like 0.013
Further Details:      
 
Domain Number 4 Region: 201-287
Classification Level Classification E-value
Superfamily L domain-like 0.00000493
Family mRNA export factor tap 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KNC26297
Sequence length 850
Comment pep supercontig:GCA_001187945.1:JRES01000997:1394276:1399369:-1 gene:FF38_01170 transcript:KNC26297 gene_biotype:protein_coding transcript_biotype:protein_coding description:Nuclear RNA export factor 2 [Source:INSDC protein ID;Acc:KNC26297.1]
Sequence
MSTLKCPDEVLHFPNHMSIEINYRNAITYYKCKQYDEKVMNQGFIWHQIVVQHYGKLMGI
EGKYAILEAIFAAVEGEEFYPVAYRRGNKEDRFLVRQCQPAMDKLFARNLCLHLPKGVVI
HLKVQLNVGEFKYGQVSPISQVTKALNALYGRMEHRNGEDGILNLSLFAQNPEFYDVVVN
LSNRGVLERVCDLIYRNDEQFRTINGIILSSNEINTLAPLKLFSGVQFAILDLSDNLLRS
PSRTCRDLEPLKADELMLQGNPLTKAVTYPECLRPVLKNFKKIDGIPSENLSSDYTPLDN
LMQTESEGYRIDWSNKTDINKFENSTDWHAFMIPDEKHQFSKEEIFDYFFLTISNNLSDI
YPCYYKFNSGEHQFLVRNCFSQIKHLVDTCNLEIKIPRLEAPPPPTNTTTDFTPQLHMDK
TVVYYLMMNISPFKKGQLEPMECIEKALNRRFSAMDRMLDLNNFQNIEGLENIVINLSSP
KILTRVLMQASRKFLSTCIELRLAHNKILSANFSKVLAMMSNLKAIDLGNNWIHDLYDIK
DIGVLGIRSLRLDGNPLCSKYCFAGEYIKTVKKYFPDLKVLDNVEITAKGNLTSQKNFLC
DTAGYDFVNEFVTRYFQTYENDRVYLKDLYHPKSVLTLTCNYNLAKLPAQNSKRILKYLN
VSRNILKIEFNRAYTSMYFGPSEIIRVLMELPGTTHDMLTFSTDCMVYNENMIVITVNGV
YLDQAPSIMETDILMGFSRTFILKPVKRNAGPLKMITNYQIINDQLNVFTPTATQTKIAF
KYFKSEDKSKKDELTLNDKEALLVMFQEATSLKSIWCTRCLDEANWNFENALEIFLQLSE
KKEIPDTAFN
Download sequence
Identical sequences A0A0L0C220
KNC26297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]