SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC27881 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC27881
Domain Number 1 Region: 345-416
Classification Level Classification E-value
Superfamily WWE domain 7.46e-22
Family WWE domain 0.00014
Further Details:      
 
Domain Number 2 Region: 133-178
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000199
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 173-230
Classification Level Classification E-value
Superfamily WWE domain 0.000000000275
Family WWE domain 0.0011
Further Details:      
 
Domain Number 4 Region: 291-326
Classification Level Classification E-value
Superfamily WWE domain 0.000000981
Family WWE domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC27881
Sequence length 705
Comment pep supercontig:GCA_001187945.1:JRES01000836:354633:365024:-1 gene:FF38_03448 transcript:KNC27881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLEESAEVITTTTPDLVEDSIATMESGPPLLAATTHSNELDDSVQIIETPIEVLDLTS
PQPSTSTSSTTNCSSGAGAVGAAACAVKRNLEETLKKEANNTDLTCTLDQQPSTSNTAAN
TASSSSNTTNLLECPICLQTCIHPARLPCGHIFCFLCVKGVAYKNRRCAMCRREIPPEFL
DHPQLVNGIEDICTTKATDDGYQWFYEGRNGGWWAYEKRNANEIEEAFQNLCKTQLQMPH
KKMKKVKVESFDKDGNRIDVKFQSEEDDDDVNEEGEAIVSNDGNNPAIPLTYDIQICGNI
YTVDFQNMLQYPQCMPYRKRKICRAKGLPAKGVAGLLSTKRNRRKRCWWQYDDRTSQDLE
EAFKKGERSCTILVAGYVYIVDFDAMIQQRQNEPARCRRVKRDLATIPKKGVAGLRIEGN
TVTTDSNFAAQVYQSRQNRYRSGELLHEADIDSPDNPILRTHGTNDPASPNTQRRLRLPY
GGLGGYVIELGNPSEFVSTAAATDAALRIASDIIGSTLAHADELTRSNSNNTPSTSANAY
QNHHLHHHQQHQHTLNQSEETSLNSSNSEANLNDLTHLNTYSSATPVTLNSNTTVNGLGL
LSSNSTNGGGVNISRERGSRELLGAAEDLLGATQRVIATADQPTIDLFEQTLNDFHALTL
RNIHDSSDDDNDAEQQQQQHQQRQQTHSTPNCQRSSSHSYNPDNP
Download sequence
Identical sequences A0A0L0C6M1
KNC27881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]