SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC28526 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC28526
Domain Number 1 Region: 166-474
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.84e-39
Family NodB-like polysaccharide deacetylase 0.018
Further Details:      
 
Domain Number 2 Region: 63-105
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000199
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 120-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC28526
Sequence length 539
Comment pep supercontig:GCA_001187945.1:JRES01000760:1360071:1372436:-1 gene:FF38_05723 transcript:KNC28526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLFVVFAVLAVAATTASALNSERVKRQATTEEPKKEESFEKELCKDKDAGEWFRLVAG
EGDNCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKEAVKNCKFKNKERRVKPLLHTDE
PLCQDGFLACGDGNCIERGLFCNGEKDCSDGSDENTCDIDNDPNRAPPCDPAVCVLPDCF
CSEDGTAIPGDLPAKDVPMMITITFDDAINNNNIELYKEIFKGRKNPNGCDIKATYFISH
KYTNYSAVQETHRKGHEVAVHSITHNDEERFWSNATVDDWAKEMAGMRIIMEKFSNITDN
SVVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNLQS
CPTRSHAVWEMVMNELDRREDPANDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHYDQ
NRAPLGLYFHAAWLKNNPEFLDAFLYWIDEILANHNDVYFVTMTQVIQWMQNPRTISEVK
NFEPWREKCTVEGKPSCWVPNTCKLTSKEIPGETINLQTCVRCPNNYPWVNDPTGDGFF
Download sequence
Identical sequences A0A0L0C8C8
KNC28526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]