SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KNC28648 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC28648
Domain Number 1 Region: 33-268
Classification Level Classification E-value
Superfamily L domain-like 4.03e-38
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 281-366
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000651
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC28648
Sequence length 883
Comment pep supercontig:GCA_001187945.1:JRES01000755:1119479:1208941:-1 gene:FF38_04903 transcript:KNC28648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVNSVAIGLLVAFALNITLMLQSVLGDDWSLSCASNCTCKWTNGKKSAICSSLQLTAIP
TTLSTELQVLVLNDNHIPYLNREEFANLELLNLQRIYLKKSEVQYVHKEAFKDLKILVEI
DLSDNRIEMLDKDTFMGNDRLRILYLNGNPLKKLVAYQFPVLPHLRTLDLHDCLLSYIDP
MALANLNMLEFLYLKNNLLENLSEYVFQHMTSLKTLVLDENPWQCNCKLRKFRSWYVNSK
LYSESLQCKGPPYHKDKTWDSVEEAQFGCSPKVEIFNNEDVQNIEIGSNVTFSCLVYGDP
LPQIYWELNGKILDSENVMFEAETIASDKLWSNLTVFNMTSLDAGTYVCSGTNVVGVGSQ
NISIYLTEIVQHVLVKTPETFWYFGLIMGTFGTVFLLILISFVACLCKRTTRQRRHPSKT
GVKPSVSFNDQEKKLLDLSITTTTNDRVDSCLDNNHSTATAMSKAESVMGFEPIEIHSSD
NHRSSVHGHHALMMGTHHQLQHPQQIQHNHSHMPPTSAAGSHVSNHPQQLMAVTDGSCSV
VGIPTSLATSVNSDGHNNHISEEFPLNVGVFPPPPEFCSNIVANPTYGNIFISVSVTQDM
LDGADISMYPDLLNIPQRLQDNGISSVVVTQQTSSNSNQVNSHGADTMSPPPSAQLQQQQ
LSSSMVGNHSSVNVNSFATLPRNSQRRGILKKDSSLQHQHQQQLPQPNLYTHDEIVSYHN
LDTTYSQGYQEHQTELIGLPPPPPPPSVKCHHGQHSTNATSKPCSGCMSTALQPPSACPS
PPKDATPLRPLYKTQNGSACLKYDNMGRRITASGNSTLSLPDEERLESETLFNDGNPLTK
TPASKVATKLQDCQSSSPTPSSGTTQNKAASINMDTGSEFVSL
Download sequence
Identical sequences A0A0L0C883
KNC28648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]