SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC32137 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC32137
Domain Number 1 Region: 1581-1882,2036-2146
Classification Level Classification E-value
Superfamily ARM repeat 6.02e-41
Family Armadillo repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 3086-3160,3315-3482
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.22e-37
Family Hect, E3 ligase catalytic domain 0.001
Further Details:      
 
Domain Number 3 Region: 1881-1977
Classification Level Classification E-value
Superfamily WWE domain 1.2e-23
Family WWE domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC32137
Sequence length 3482
Comment pep supercontig:GCA_001187945.1:JRES01000339:462895:511701:1 gene:FF38_12445 transcript:KNC32137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESVNCQSLSAVTEGHDGSILQTYATNITTGLNTTNKNTAKHRRGGRQQQQQQQHHQQQ
QQQKQHQQKQQQQTHNNNISKNLTVTQTTTDKRSRSKSRSASAHQEHHQQQQTPFNNNSS
KRTSSRNSTFNASTSSSSAVISPASPITPPPSTRSDRKRHFVEKSAISTATTTSANYSSS
SIGDHPTDLTSPLKKRRYHNHNLQDIDSTPLSTTSGNSSSSSKYNTPKEQEGDCVARRTR
SKTVSPEEPSTSSGGGGIYSSSAYNQRRGSYTKTAATQQQQYQKLGFETTPQRSTATTVT
NNCAGSSSSSTNTNNNNNKNKGNLLNYYRKTRKISHSRSSTTTTTATTSSTATTTNSNNT
TKRAAALNNSISSISDESSDTSSSETQQQKHQLKQTKTNALTSEEKYKFKSSTGSSRHKK
RNYRNQNNKINKKKSSSTNTASSATTPSSQQQLLSARSNQKIECSSNNVVADKKQQQQQQ
NKNFLSIVGNKTKLNTKSTQNTTASSTTTSATLATESATTSSNTNTFGSNHDQQEQSQSP
PTLHLDKISKYRKSLRTYQNFLNNLTDELNTATTQNQQQTNETNAVVGDNIHQQQANSSK
NSSNSNTEPQRSSSSSYHCNIDKELFAVLSASIESEEDEEADDNNTAEEEEVVEEEEQIE
EEEDEENNDDENIADDDVDNNDDVEEEEVVDEDEEIELLDEDDDEEEDDDDIGDEEEDID
DEEIEEEEEDLDDDIHDSVLAIRGKRQQQQHQRSQQQQQQEQLKLNKKRLARSGRQQNEK
YLNQENCLQNPTKQTQPHQQQQQTQRRLKERSGATQHNHNRLAQEVASEEITTSATLQTT
ATTTGYNRAPNLGARQTRSSGGSASTNTNTASNNTDYNIGVHQHQQQHHHHHTQHQHPHQ
TSTGGAATAAGTSSAAAAAAGIGVGGNTQNSAAGLNHNLLNRTGGVVIGPPPGVHSNLQQ
QQQTQQHSTNQHHTLIATTTHFPQQQQHPTAHLLQHPSQGSQAHYLSQQTGPTFYTGHPQ
AHLQAQPQQQVHFYQTYPAGNSASSAAILNLNLNSYPTAGNTTTAAAVVGGAPLIYQVQP
PQQGALLSQQTTSHRYHHQVQPQSAPPNLHHQHQQHQHHQTQTQHLQQHPTAIELTLGGT
LPVGTHDTNIVYQATNYSANSNNSHTHSHAHQHPQQQQQNSHTLRRSSRSKTGSCVSSVQ
GQHHGSASSSSSSGNSSGGNTNHRSAATNAASLSVVVGHQLQQQQQQQQPPQAAHQLAAA
AHQHHQTHIVQQQQQPPPPHHQLLGSHHQHPVHPPPNLHHQQQHQHHQTVATAGGAVVVA
ISQQQQQQPQNHLLHAQPPHPHALPPQRTTIVQPGFLYSYRTTVGANNSSASTASGLGTS
SSSSSSGAAAAAATATNNIVATNVVPPTNTSYLATHQNSNKTSASADALSYNLMAQQQSN
TGSVPSLPPQPVAHVVNSHLATAASAGGLINSNTASLSVANALGSTTSSNTNNSATATGA
NVNPAAAANSGAGGPNNTATTTSSNNTNSNSHGDSESDDSEVGRLQALLEARGLPPHLFG
ALGPRMTHILHRTIGNSSTSKAQQLLQGLQSHDESQQLQAAIEMCQMLVMGNEDTLAGFP
IKQVVPALITLLRMEHNFDIMNNACRALAYMLEALPRSSGTVVDAVPVFLEKLQVIQCMD
VAEQSLTALEILSRRHNKAILQANGVSACLTYLDFFSINAQRAALAITANCCLNLHNEEF
HFVSESLPLLARLLAQQDKKCVESVCSAFCRLVESFQHDPKRLQEIASKELLKNCQQLLV
VTPALLNSGTFTAVVRMLSLMCANCPDLAISLLKSDIASTLLYLLTGNADPLPKSASTHV
ELISRSPSELYEITCLIGELMPRLPTDGIFVVDALLDRPTINTQDQVQWQWRDDRGTWHN
YSTIDSRMIEAAHVNSEDEFSLSTLGRTYTVDFHSMQQINEDTGTNRPVQRKINPNYRPT
ANTSATTGQDLSASAVASAITALSTTVTATATGGSTPSGSQKRRASVDARIACLKEERGL
AAEFIKNLFNVLYEVYSSSAGPNVRYKCLRALLRMVYYASSELLSEVLKYQLVSSHIAGM
LGSNDLRIVVGALQMAEILMQKLPEIFGTHFRREGVIYQITQLTDPNHPICANPSPKPLA
TNMSASGSQSAPASASSLQVNPFFMDNVPPQPGSTSASGTPNTSKPHHQHPYTMKTFSHA
MNALTAAAAQQGTSPSGSSSNSQKLPTSMAMNINTSGGSSAAQNPNNEMPQYHYSSSAPA
HTHMGNPQQQQQNFFVYTTSPQQQQQPPLPPPGTEYVAYNQLPPPPPPSTHYAAASGAQQ
QQYHSMPSSSASAQGQQNVNTTPGTSSTSGGASSSSSSALQNKMSDMLKRKVPPKRKSQS
TTRSKSRQEDQTSSSTSTSNAQAASSSPTVHELLSRATSLGGGSTGSGSAGRSTPSTSSK
VRFSGGHHSSSSGQQSSKTSSFLASLNPARWGRQGSHHSSSSAASNSGFTKDSTSSSSTT
SSHHNHSHPNSSAGSSAGHSMAGCSSLAAQNISKSISQANLIAAGNREKARQWIREQAIS
FIKRYAAQDTKPGATADGSASTNVLQRLTSVISKLNGSFSDVLEALLELKTILLESDISP
FEVNHSGLIKAMLNFMTAEEGIVERDARLRAFMHVFAGLPLEPMVKVGILPNIDATAFGA
FVSKLNACVTQLEQFPVKVHDFPAGPGGGRSNTSALKFFNTHQLKCNLQRHPDCNNLRQW
KGGTVKIDPLAMVQAIERYLVVRGFGGIRGDSDDDSEEDMDDNVAAVVMSQSGFKHKLQF
LIGEHVLPYNMTVYQAVKQFSPLVNDQSETDTDTETPLGNASIWVQQHTIYYRPVEEEPV
AATSSSSINNKSNIPGAGTSSSIHNGAMVASGSTTGGPSTSVGKKSNKSSSKLLRKKTEL
WHEGIAPAVVSALKPFLTNTLPADVVTSVQDASLDALCMLRIINALNRHWEHLYGCVHRQ
SIIPQSEFIHPKITAKANRQLQDPLVIMTGNLPQWLPQIGMACPFLFPFETRHLLFYATS
FDRDRALQRLLDTTPDLNSAESSERVAPRLDRRKRAISRQEILKQAEHLIQDFGHSKALL
EIQYENEVGTGLGPTLEFYALVSAELQRSDLGLWNGSDSYKQNSANIVDVVKSTSATLHI
DESQDTNSQSGDTNITTTTNTTASPNTASTRNASRNNRESLGVATRSSLVATNNSINNQQ
QQQQQHSPQAGEDALDMLIEQQGDLIDQHTGGDPSMPLLDNPIAVTTATTPVLQVNNTPH
QANVTYVNTAHGLFPLPLGKSSKLPHVSKVKSKFKFLGKFMAKAVMDSRMLDLPFSIPFY
RWILNEEHSVGLADLSRVAPEVQSTLVRLQDVVHQREMILADTSLDAMEKTEKIESLDLD
GCPIADLGLDFILPGHANIELCRGGRDTPVTVHNLHQYISLVTYWFLVEGVQKQFEALKE
GM
Download sequence
Identical sequences A0A0L0CIT9
KNC32137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]