SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC32453 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC32453
Domain Number 1 Region: 574-959
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.59e-126
Family Oxysterol-binding protein 0.0000243
Further Details:      
 
Domain Number 2 Region: 200-323
Classification Level Classification E-value
Superfamily PH domain-like 2.22e-23
Family Pleckstrin-homology domain (PH domain) 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KNC32453
Sequence length 1086
Comment pep supercontig:GCA_001187945.1:JRES01000310:2241349:2277192:1 gene:FF38_05019 transcript:KNC32453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSSVNSSSGTTAGGGAGGSSISMKSGSHSNLTVTGSSTSTPIRIASYHGHVSSSTGND
SPTPSSTASLMQQQSPQYQQSSSVPSTAGGVGGGSGSVVGQLGQSSASLNMGISTHQQQQ
SASTNAMSTSITPPNSAGLRQSGGIANWASDSRDKYDGNQTDKTSTDTSKLNRKESYKAQ
RKNYRREKKRVASELLNSLQDPAVIVLADWLKVRGTLKSWTKLWCVLKPGLLLIYKSPKT
KSSHWVGTILLTSCQVIERPSKKDGFCFKLFHPLEQSIWAPRGPDKETIGAVTQPLPTAY
LIFRAPSQAAGKCWMDALELSLRCSGLLLRSNSTPGTNQGTGTVEASISHETQWSEADYE
KHFDDQVPDMDYLHKSPHGSEVSIVSSRTQTPLLQQLYLSMTNWERLVGSNALEFNKKLR
KLHKSKKSAGGDYSDASSVDFSPKLSKSLKMYKNRKTFKVPLIKSQSLGSVHTTTSSSDE
EYEPIMLQKSLSMNAVTSRSISCPPDLDGDSQNEAPTGIMSGIDTDSDSDGNDVIGVDNQ
LQQIDNEDPIETPYIPMPEEEINTQSGEQVEELAEENKSLIWCLVKQVRPGMDLSKVVLP
TFILEPRSFLDKLSDSYYHADILSRAVNEDDPFTRMKLVVQWYLSGFYKKPKGLKKPYNP
ILGETFRCYWEHPNGSRTYYIAEQVSHHPPVSAFYVTNRQEGFCISCSILAKSKFYGNST
SAVLEGVATLTLLPRGESYTLTTPYAHCKGILMGTLSMELGGKINIDCENTGYKTELEFK
LKPFLGGSDSTNIIAGKIKLGKETLATISGHWDGEMRIKDSKSGEDSVLFAANRETMKKR
LLRYVVPIESQLPNESERLWNLVSAAIARDDQVGATEEKTVLEEQQRNAAKERKATFAEW
EPAHFQQDLITGKWIYKYADLRPWDPRNDVKQYEWDYKVLTKTRHQAPMVRTASIVSVDP
RQSSMVLMKSKRKNKSKVPLVSNDPNNSDSSQSHDDFTICDQPVSSQTIRKLMLAVDQIN
KSLDDHKRQLLLINSKLERLQYAPHNASTQSHSSLWSALPQSLVIRASAYAFAALLVSLC
LKWLLY
Download sequence
Identical sequences A0A0L0CJ88
KNC32453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]