SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC32548 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC32548
Domain Number 1 Region: 30-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 99-140
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000275
Family Hairy Orange domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KNC32548
Sequence length 234
Comment pep supercontig:GCA_001187945.1:JRES01000302:512835:515799:-1 gene:FF38_03107 transcript:KNC32548 gene_biotype:protein_coding transcript_biotype:protein_coding description:Enhancer of split mgamma protein [Source:INSDC protein ID;Acc:KNC32548.1]
Sequence
MSFTARMPPNHQFMLNSLPMEPVSRTYQYRKIMKPMLERKRRARINKCLDELKDLMTGTL
QADGENVSKLEKADILELTVRHLQRLREKNALFVRHNESLNMEKFWSGFQHCAAEVAQFL
NKYDQHISGELIQHISSYVPNIRATPGGAATSNSAIVNSRVGNSFTAPRAVISRELTAYN
QRIPYNKITVGQMPIMPINSHNMHSKEEPQMLYEMGREMKKELVEEGNSVWRPW
Download sequence
Identical sequences A0A0L0CJG2
KNC32548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]