SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC33543 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC33543
Domain Number 1 Region: 137-188
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000183
Family Hairy Orange domain 0.00039
Further Details:      
 
Domain Number 2 Region: 73-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000602
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC33543
Sequence length 467
Comment pep supercontig:GCA_001187945.1:JRES01000182:3422:6481:1 gene:FF38_03824 transcript:KNC33543 gene_biotype:protein_coding transcript_biotype:protein_coding description:Hairy/enhancer-of-split related with YRPW motif protein [Source:INSDC protein ID;Acc:KNC33543.1]
Sequence
MDHNMHHNNAALHWSYGAAAVPTTPQNHWVPPPQTHSLKRAMSESDCEELYSEESSKEQI
SPSETNSCQLMSRKKRRGVIEKKRRDRINSSLSELKRLVPSAYEKQGSAKLEKAEILQLT
VEHLKSLQSKGMDSLGYDPQRFAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMS
HLQYFVQQREMSKGCPVSPSASWAGHPAAASTAAAAAAAYQPNCGVTPYQTYPSASTTHA
SVSSSYVPNLPAALHQYPTLSSSPNSTNMHSQQQQQQHNMTQQHSVRSTSVGSAQDTLPL
MNHATAQQVTTQQQQQQVTSQQQQQQQQQQSQTQTQQQVTHPQRTPSSHEAHQQPQPQQQ
PQHQQQQQQQSQLTNNQATHHTYTQNHTQDHTQHQGASTYIELTSAQTHNSLRQTTPTVP
SSSLGYTTSMAPQYPVSVGQEYNHQTGVYVTANGSKPYRPWGAEMAY
Download sequence
Identical sequences A0A0L0CMG8
KNC33543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]