SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC33674 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC33674
Domain Number 1 Region: 57-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 121-171
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000615
Family Hairy Orange domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC33674
Sequence length 473
Comment pep supercontig:GCA_001187945.1:JRES01000171:1352300:1355655:1 gene:FF38_08755 transcript:KNC33674 gene_biotype:protein_coding transcript_biotype:protein_coding description:Protein deadpan [Source:INSDC protein ID;Acc:KNC33674.1]
Sequence
MDYKNEFQSDDDFDCSNSYNNDNFQQQTAAQNAAQNQFNTSQGRLNNNAGLSKAELRKTN
KPIMEKRRRARINHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNM
ALQTDPTVIHKFKTGFMECADEVNRYVSQLDGVEDGVRQRLNSHLNNCATSLEQIGSMTN
FSNGYRSGASSNFFANTNSMPLPTTGSLFPALPQDLNNNPAGGIQMGGVQLIPSRLPSGE
FALIVPNTANNTTAAASLINSNSNSGFPSWPGNNTTAASNNSTPINDFAANFKRLSAFSK
PQNTLITPLKVPVGNSYPQTNLTHTNYQLQTTQQQQQQQQAFHTTTTTSPPLSPISSVSS
HNEDSNMHTSSDFTNSRSVSPRQDKHNSFSGVFASPPSSAENSFVLSAAHLQQQQVTSTS
SNSDLNTSSSSSLKRSFSETADSSICSEDEHTSKKYQREQQDAEDQDSMWRPW
Download sequence
Identical sequences A0A0L0CQG1
KNC33674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]