SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC34253 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC34253
Domain Number 1 Region: 27-123
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-16
Family Phosphotyrosine-binding domain (PTB) 0.0023
Further Details:      
 
Domain Number 2 Region: 138-181
Classification Level Classification E-value
Superfamily PH domain-like 0.0000676
Family Phosphotyrosine-binding domain (PTB) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC34253
Sequence length 187
Comment pep supercontig:GCA_001187945.1:JRES01000086:15959:95680:-1 gene:FF38_13131 transcript:KNC34253 gene_biotype:protein_coding transcript_biotype:protein_coding description:Insulin receptor substrate 1 [Source:INSDC protein ID;Acc:KNC34253.1]
Sequence
MDNISTYVLSKKKMSKQRLSVLNDDGVLLCGYYKKLKTMKKKFFVLYNETPCKVARIEYY
DTEKKYKSGFTPKRIIKIKNCFNINRRFYTKHDFVIVLASKEGGFGIVMDSEDEINTWLH
HLLHLQRSGETCFDLPNFDYVWQVVIQKKGIAEQHNIFGSYHICLTNKSVTFIKIGREKN
FLTDFLF
Download sequence
Identical sequences A0A0L0CPF4
KNC34253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]