SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KNC34407 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC34407
Domain Number 1 Region: 41-270
Classification Level Classification E-value
Superfamily L domain-like 1.17e-43
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 268-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000272
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC34407
Sequence length 967
Comment pep supercontig:GCA_001187945.1:JRES01000067:1030766:1033669:-1 gene:FF38_00739 transcript:KNC34407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCLSRKTIVLVICYTLLLNCVLIQGVEGCPAEVCICKWKGGKQTVECGGQSLPNIPEGM
DPGTQVLNFSGNSLQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLS
ENSLQHIPSETFQDYSSLMRLTLSGNPIRELKTAAFRYLSFLTTLELSNCQIERIENEAF
VGMDNLEWLRLDGNRISYIQGNHILPKSLHGISLQSNRWTCDCRLLDLHSWLNNYNTPQT
EEPKCVEPPRLKGQVIKSLKREEFACLPEVSPQSTYTEVSEGRNLTISCVVRAIPEPKVL
WLFNGQVMSNDSFVDNMHMLYYIDESSTTSEEKRSEIFIYNVGIEDNGTFSCVGQNIAGT
TFSNYTIRVMIKEPPVVNEVSFPQNYMNYIVASSAGGGIIFVLILAFIIIQCKKRQTPVK
RKKCPSSGVTSVNGNNTSSSDGSSNNDNGLMKCSSIINDNDSLNNSSGLMLGQCDTLTPT
KLSKENGVILGNQIKQNIMMYNPLDSSTQTLQLSVNMAQASSLNSGTPPPPPQSLMVNPV
LSSTLAYCSPPSSLRNYAEKNPDLVNDAESGYKHKLKTSSSLDAGGSEYDSQSDCQNPVQ
YDQYYQLSAPQFGSQILRPNTAASMASSRFGGMTTLPRGMQLKTVMNSIPTHPVDVHLNP
VCFLGQDGFAYDYTNAHLQQSPQQPPSHHHLMQQQSAAQQQQQQQANIQQQQQQNFYRTL
PHNRAHKQQQFANANNNNGMRYSLEAEFLQQRSGTPTSYDKYNIPNVRFTAEGYPQTHLV
QYPSPPEGYKSNTDQQQQQQQLHQQQQQWPPCLPGYHAQPIHYTPTIMGMLSPQQQQPLT
SINTTTPLSTNTPPVTTMSSASSQTNMDAQRKRCVVGQVDSTTIPECDETDISPTTSSLT
VSVTQQQQLQQQQSQQETTSCSINTTEKNTKARHLNGPLADSPDEGYVGDSHDTAVTTTS
SAPSQEI
Download sequence
Identical sequences A0A0L0CQG3
KNC34407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]