SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KNC34858 from Lucilia cuprina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KNC34858
Domain Number 1 Region: 163-465
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.97e-37
Family NodB-like polysaccharide deacetylase 0.019
Further Details:      
 
Domain Number 2 Region: 59-109
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000314
Family Tachycitin 0.023
Further Details:      
 
Domain Number 3 Region: 118-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KNC34858
Sequence length 529
Comment pep supercontig:GCA_001187945.1:JRES01000022:33051:35885:-1 gene:FF38_02231 transcript:KNC34858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLQILEIPLKIPFLTAVLGNTIKSGQNHTQRSLSNSVDCLEDLRFYRDPNRPVHKIWTS
SECSKYYLCLEGEVFNFKCSEGLLFDVVRQICDFKQNVDNCDITAETPVPKPLLDEAICE
EENHWGCGDGTCLPNEYFCDGSVDCPDESDEGWCDAENDPNAAASCDPRKCKLPDCYCSK
DGTQIPARLEPQSVPQMILLSFDDAINFENWELFSQVLFRGHRRNPNGCPIKATFFVSHP
FTNYQYVQKLWNDGHEMAVHSVTHRGPEMWWSHNATIEDWFDEMVGQANILNRFASVRME
EIRGMRVPFLRVGWNRQFLMMKEFGFVYDASMVAPFSNPPLWPYTLDYKMPHTCTGSQQN
CPSRSYPGIWEIVINQLEAGDFTCTMIDSCPPHLSGDDIYRMLTHNFKRHYLSNRAPLGL
YFHATWFKKADYLNAFLKFLDDLQKLPDVYFVTNQQAIQWIRQPTTNTDIHQFSAWGCKP
KQLDKHEMVCTLSNTCKLRSRVLQQDRYFYTCKECPAQYPWIRNEFGLD
Download sequence
Identical sequences A0A0L0CR97
KNC34858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]