SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aurpu_var_sub1|51250|gw1.38.21.1 from Aureobasidium pullulans var. subglaciale EXF-2481 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aurpu_var_sub1|51250|gw1.38.21.1
Domain Number 1 Region: 120-204,264-319
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.71e-18
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aurpu_var_sub1|51250|gw1.38.21.1
Sequence length 447
Sequence
WRSFWHTMTSNDRHASPDMPYRTGAHTPLAQSRHAPLTSVATAAESRTDLDNPYAQDNDF
MPADGRMSPNGPYSPGLRSTMQRQSSSGNLEGVGQGEIQMQSFSEGLPPPPPVGHSWRRI
DSWAENNHEELFENLCEGCTQNDVNELEHELDCTLPMEMRESLMIHDGQERGGRPTGILF
GCMLLDCEEIVQEWKQWARVGDDYLRASSAPYAAPQVPNKAFAGSSTQPSAAPQSASGAG
WRSELMAKQDSHPPNAVQKAYVHPGWIPVARDWGGNNICIDLAPGPAGKWGQVILAGRDY
DCKYVVARSWSAFLAAVADDFSTPKAVVDEDSGELTLREFKNQNVDPSYMDILRWRTDQK
YGRRAPKGARPQQPLRINSNVKNEFSSLNGFSPYASPTGSDRGRSPQRFSSNGKAPANQS
PRGHVSSPLARVAEEAAPTPLRTDNLD
Download sequence
Identical sequences A0A074YV27
jgi|Aurpu_var_sub1|51250|gw1.38.21.1 XP_013339160.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]