SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LmxM12.0530 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM12.0530
Domain Number 1 Region: 50-601
Classification Level Classification E-value
Superfamily SIS domain 7.51e-216
Family Phosphoglucose isomerase, PGI 0.0000000000000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM12.0530
Sequence length 605
Comment | organism=Leishmania_mexicana_mexicana | product=glucose-6-phosphate isomerase | location=LmxMchr12:294103-295920(+) | length=605
Sequence
MSDYLSKLKEHVVESTKVSGCTPCMATSTFNAPHEVARRTKMLGATDSSLLNLPAWKRLQ
SLYERHGDESILSHFESDHQRFGRYSIEVALQREENFLFLDYSKSHINDEIKDALVALAE
ERGVRAFVKAMFDGQRVNSTEHRAVLHVALRNRSNRPIIVDGKDVMADVNNVLAQMKSFT
EKVRSGEWKGQTGKSVSNIVNIGIGGSDLGPVMVTEALKPFSKRDMHCFFVSNVDGTHMA
EVLKQVKLEETVFIIASKTFTTQETLTNAMSARNALMDYLKAKNISTDGAVAKHFVALST
NTEKVREFGIDTANMFVFWDWVGGRYSVWSAIGLSVMLSIGYDNFVEFLTGAHVMDNHFA
SAPVEQNLPMMLALVGIWYNNFFGAETEAVLPYDQYLWRLPAYLQQLDMESNGKGVTKKS
GAVAVQTGPIIFGEAGTNGQHAFYQLIHQGTKIIPCDFIGCVQTQNRVGDHHRILMSNFF
AQTEALMVGKSAEEVRQELVQSGMSGDAIESMIPHKTFTGNRPSNSILVNALTPRALGAI
IAMYEHKVLVQGAIWGINSYDQWGVELGKVLAKSILPQLKSGNIVSNHDASTNGLINLFN
TRAHL
Download sequence
Identical sequences E9ANY1
XP_003873158.1.65987 psu|LmxM12.0530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]