SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LmxM32.3050 from Leishmania mexicana 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmxM32.3050
Domain Number 1 Region: 289-424,473-640
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.28e-54
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000776
Further Details:      
 
Domain Number 2 Region: 9-108,142-201,228-286
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.36e-35
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LmxM32.3050
Sequence length 682
Comment | organism=Leishmania_mexicana_mexicana | product=tyrosyl-DNA phosphodiesterase-like protein | location=LmxMchr32:1485832-1487880(+) | length=682
Sequence
MNGGGATRHAEACFPFWVNDVGSFTSVPQGRAPSSCSLLRLRDLFRCDLADPGECWQHIL
LSSYVTDLRWLLATVPELSAVTGKLVVLSGEKGTATLRRTTGDPSSPYTATSPLMDRVNP
FMAALREQARATSALHTTLSRERLAVLEPPLPVAFGTHHTKMALCVNSRGLRISIFTANL
VEQDWCWKSQGIYLQDFPWKAATECSNDVAAGATVVKTAASSTSKGGNGSNTLTKGAEFV
AHLRNYLMQCGVSLTTACASPTDAVSAAGPLGIFETDFLSHIDFSAAAVWLISSVPGTCA
YGEVAPGYRVGLCRLAEVLRRSALTMATAPASVDLSWQYSSQGSLNLAFLNSLQAAMCGE
SVSVIESGDTPRGVRDVQVVYPTEEEVRNSWEGWRGGGSLPLRVQCCHEFVNARLHRWGS
SEEGHTAKRAFPRPAKVAAAHASREDAVDVDGVDSDGGEGTTASLTCSCAAYRQFALPHI
KSYAAVAPDRSCVRWFLLTSANLSQAAWGSLSRKMNQRGSRQQLVRSYELGVIYDSHSAI
HPSASSWFSVVSKTKIELPSARNSRAMLYETPLGVETQNVCLYTPYNLLCPTPYASTAAL
RARRDAPVEGEQAVAGSTLDCSDVPWVLDMPHRGRDAYGLDFEEAFESSVSPNLSKWQPR
TRAMETAPLHNIGAPRKRTREA
Download sequence
Identical sequences E9B4E6
psu|LmxM32.3050 XP_003878563.1.65987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]