SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805155|ref|YP_005841553.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805155|ref|YP_005841553.1|
Domain Number 1 Region: 34-213,246-388
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.44e-46
Family Tandem AAA-ATPase domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805155|ref|YP_005841553.1|
Sequence length 878
Comment ATP dependent helicase [Fervidicoccus fontis Kam940]
Sequence
MRKSDLEEVLRPYTLEWFRWSFGDFTEPQKRAIPLIKRGENVLISSPTGTGKTLAAFLGI
IDALYALSEEKKLENEIYVLYVSPLRALNNDIRRNLIEPLEGIKKIAREKYGVELEDIKA
SIRTSDTPQNERQIMLRKPPHILITTPESLALILVAPKFRERLRSIRWVIIDEIHEIASS
KRGSNLSILLERLQELAEREVQRIGLSATISPLEKIARFLGGYGDDGKPRSVKIVDARFK
KPFDIRVLVPVKDMIYASEEELSDGIYSKIAELVLSHKSTLIFTNTRSATERVVFKLKKV
LAEKNLVGLDDIGAHHSSLSRDIRLDVEERLKRGELRVVVSSTSLELGIDIGYIDLVLLL
SSPKSVSRLLQRVGRAGHRLHEVSEGRIITVDRDDLVECSVLADAARKRLIDKTKIPEAP
LDVLAQNIVAMSLEKKWRVEDAYRVVKRTYPYHKLKYEDFLSVVKFLGGDEKRLEEQKVY
RKIWYDPEENAFGKKRSTRMIFNLNQGTIPDEAKIKVFLKGRKYIGDLDEGFAQILSPGD
VFVLGGKTYVFKKLTGLKMFVDSAEGQRPTVPSWFSEMLPLSFDSALLVGKFRRHVKELL
EKYGFDLNKASKDIADEMMLDEDAAREVARYISEQYAFTSGIVASDRLVHIEIYDDERGR
NIIFHSLFGRKANDALSRAYAYALSEQSGTAVRVTVSDNAFMLTLPGRPEVDVSTLVKSV
NSKNVEDLLTKSIYNTEMMKRIFRQCAQRSFMILRNYRGWEKSPNKLQLSAQTILDALKE
DSENPVVKETVREIIHDHMDVDAAKEVLKRIEDGEIEVEITGPSEVPSPFAHHIIAIGYQ
DIVLMEDRRRLLLSLYEKVRKYIENNEKMRDNLAFSSS
Download sequence
Identical sequences H9ZZE4
gi|385805155|ref|YP_005841553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]