SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805280|ref|YP_005841678.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805280|ref|YP_005841678.1|
Domain Number 1 Region: 7-304
Classification Level Classification E-value
Superfamily Pseudouridine synthase 6.62e-30
Family tRNA pseudouridine synthase TruD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805280|ref|YP_005841678.1|
Sequence length 321
Comment tRNA pseudouridine synthase D [Fervidicoccus fontis Kam940]
Sequence
MIYERIGINVFLTNSEGIEAGDFLERCSDFIVIERSFPPTNNEGKFYAYFLVKSGLSTES
AVKIILTLIHKGKAFYYGLKDSNSLSVQNIVLTEFVGKNLCFGGKARLIYQGKTDFIPKK
GGFNSNIFAIKFPDSIDAEKTLEEIKKLKAFPNFFGHQRFGFHEPFNHEIAIKLLKDGKL
NTRSWKGEFLAESLQSYIFNVCLSRIDFKEDYNSKMGILLGTRHKEALKKKVLLKDHYEC
SLEVAEELGILELIEGKDFLKYQLRPLFIKNPLIKYYKSKEKLIAIAKMPPGSYASLIIR
EVFKNDESWMNKKCVAEKVCK
Download sequence
Identical sequences H9ZZR9
gi|385805280|ref|YP_005841678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]