SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805295|ref|YP_005841693.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805295|ref|YP_005841693.1|
Domain Number 1 Region: 5-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.86e-38
Family Nitrogenase iron protein-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805295|ref|YP_005841693.1|
Sequence length 256
Comment putative ATP binding protein [Fervidicoccus fontis Kam940]
Sequence
MECKYVVFMGPAGSGKTTLTATFSDWLSSQGIDNVKVNLDPAVEYLPYDPDIDVRNYVDA
REVAKKYSLGPNGALLASMDLLYGKLEDIKKELMEIEGEYVLIDMPGQLELFSFRSTGPL
IVDRLSSKNRTAVVFLMDANFTASVENFLSILMLSHSIRIRHYFPQINAISKIDLLSPEL
LEELLTLKESPELLKEKVIDKGDPKYHDYINSIADFLIEEGIDFIPVSSTTGEGLDELFA
SIQNLISNLDEIETNL
Download sequence
Identical sequences H9ZZT4
gi|385805295|ref|YP_005841693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]