SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805325|ref|YP_005841723.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805325|ref|YP_005841723.1|
Domain Number 1 Region: 103-259
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.3e-21
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.011
Further Details:      
 
Domain Number 2 Region: 19-108
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000276
Family Ferredoxin reductase FAD-binding domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385805325|ref|YP_005841723.1|
Sequence length 268
Comment oxidoreductase FAD/NAD(P)-binding domain-containing protein [Fervidicoccus fontis Kam940]
Sequence
MQNLRGIGKMEKKKFEIKPVKIERNEEVAENTFLISFLPLEDLSLEVKPFNFFMVWIPRI
DFIPLSVSDYDGNSLTFLYKIKGNGTKALSLKKKNEILGIMGPLGKEFFFKNGEKILVVA
GGIGIAPIPYFVKFSKGSEIDLVWGVKKGSELFEVTKIYGKMNNLKNFIIYTEDCSYGKC
GKALDALREIRLNEYNRILSVGPEVMMKNFCNLCNKKNDCYVALENLTKCGMGICGSCYI
KGTTKLMCSDGPVFECSEVKYHFESIIA
Download sequence
Identical sequences H9ZZW4
gi|385805325|ref|YP_005841723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]