SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805405|ref|YP_005841803.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805405|ref|YP_005841803.1|
Domain Number 1 Region: 451-714
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.72e-79
Family Extended AAA-ATPase domain 0.000000335
Further Details:      
 
Domain Number 2 Region: 177-442
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-73
Family Extended AAA-ATPase domain 0.0000000977
Further Details:      
 
Domain Number 3 Region: 6-93
Classification Level Classification E-value
Superfamily ADC-like 1.99e-29
Family Cdc48 N-terminal domain-like 0.001
Further Details:      
 
Domain Number 4 Region: 96-185
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 5.56e-18
Family Cdc48 domain 2-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805405|ref|YP_005841803.1|
Sequence length 731
Comment AAA family ATPase-domain containing protein [Fervidicoccus fontis Kam940]
Sequence
MSTTNEKKELLLRVAEAKQKDVGRGKVRIDLEMLKEIGVEPGDVVEIEGRRKTAAIAWPN
YTEDQGQDIIRMDGLVRKNAGVSIGDKVIVRKAQTKPATYVKLAPNNYNIEVENSFVNYI
KRRLIDTPVVEGDTVLIPVLGQPIPFSVIQTKPIGIVIITNETNLIVLDKPVDTGKMPRV
TYEDIGGLKPIVERIRELVELPLKYPEVFKRLGIEPPKGVLLYGAPGTGKTLLAKAVANE
TQAYFVAINGPEIMSKFYGESEQRLREIFEEAKKHTPAIIFIDEIDAIAPKRDEVIGEVE
RRVVAQLLALMDGLETRGDVIVIAATNRPNAIDPALRRPGRFDREIEIPLPDRQGRLEIL
QIHTRNMPLAEDVDLEKIASITHGYTGADLAALSREAAMHALRRYLPKIDLNSERIPEEV
LNSMVVTMQDFMEAYKEIIPSGLREIYIEVPNVKWSDIGGLEEAKQQLREAVEWPLKYPE
SFKKIGIRPPRGVLLFGPPGTGKTMLAKAVATESEANFIAVRGPEVLSKWVGESEKAIRE
IFRRARQYSPVIIFFDEIDSLVPIRGMSSDSYVTERVVSQLLTEMDGIESLENVIVIAAT
NRPDIIDPALLRPGRLEKLIYIPPPDKDDRLEILKIHTKKMPLASDVDLERIAEITEGYT
GADIEALVREAGLRALRENLSATEIRMRHFEDALQVIKPSITKQMIEYYIKWFEQARQAI
SKKIIETTPYI
Download sequence
Identical sequences I0A044
gi|385805405|ref|YP_005841803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]