SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805432|ref|YP_005841830.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805432|ref|YP_005841830.1|
Domain Number 1 Region: 101-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.94e-63
Family Extended AAA-ATPase domain 0.0000119
Further Details:      
 
Domain Number 2 Region: 7-72
Classification Level Classification E-value
Superfamily MIT domain 0.00000000000759
Family MIT domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385805432|ref|YP_005841830.1|
Sequence length 376
Comment cell division protein CdvC [Fervidicoccus fontis Kam940]
Sequence
MAFPYLQEMATRYARAAVAADKDGDYETAINNYRKAIEILTKIVRMYPDSPLISTYLEMI
KSYEKRIQQLQSNTEAIESNTASKSNEKDSFINDIVLTQKPNVKFSDIADLKEAKQAIVE
AIVYPVKRPDLFPLGWPRGILLFGPPGCGKTMLAAAVANEVNGYFLYVDAASIMSKWLGE
AEKNVSKIFKYARQKSEEGSPAIIFIDEIDALLGTFSGEVGGEVRVRNQFLKEMDGIQDK
DKKIHVYVIGATNKPWQLDEAFVRRFNKRILIPLPDLESRRQLFALYTKGLNLSSDVDLD
RLAQLTEGYSASDIRDIIQATHTLVIREFFEQKNGEGEPRSITMEDFLNILKERKPSVDP
LFVKRYDAWFEKFKAL
Download sequence
Identical sequences A0A2J6N8H6 I0A071
gi|385805432|ref|YP_005841830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]