SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805440|ref|YP_005841838.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805440|ref|YP_005841838.1|
Domain Number 1 Region: 11-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.75e-20
Family RecA protein-like (ATPase-domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385805440|ref|YP_005841838.1|
Sequence length 252
Comment AAA ATPase [Fervidicoccus fontis Kam940]
Sequence
MIGKSMQLPLVSDLMEGNLSEGIYVIAGPPGIGKSVFVKRLIANSIADSYILYVSVDSSI
KDMLEFLEKMNISKYKDHIQFLDAFSTTFTGIKQDIQYEKINLESASDSLFTIYSKLSQM
DGNKILVIDSITEMLIGTDPDTSISFIKGLKQITESTHTLGVITIHTGPDSLKDILWILE
YLSDGYIELAFEPNFEAVGILLRRIRIKKMRNKFHDSNWYPYKIVKDYGLQFMSPQELKA
IADVVTGKKSSQ
Download sequence
Identical sequences I0A079
gi|385805440|ref|YP_005841838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]