SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805491|ref|YP_005841889.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805491|ref|YP_005841889.1|
Domain Number 1 Region: 13-299
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.23e-49
Family G proteins 0.00000066
Further Details:      
 
Domain Number 2 Region: 344-467
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 2.09e-31
Family Initiation factor IF2/eIF5b, domain 3 0.0000333
Further Details:      
 
Domain Number 3 Region: 475-600
Classification Level Classification E-value
Superfamily Translation proteins 1.04e-27
Family Elongation factors 0.0000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805491|ref|YP_005841889.1|
Sequence length 606
Comment translation initiation factor aIF-2 [Fervidicoccus fontis Kam940]
Sequence
MIKLSGTSRIEEQKLRQPIVVVMGHVDHGKTTLLDKIRGTSVAKREPGEITQHVGASVVP
SRVIEQLAEPLKKIIPVKLKIPGLLFIDTPGHELFMNMRRIGGAISDFSILVVDIIEGFK
EQTVESLQLLRARKVPFLVAANKIDKIPGWKPYPNEAFINSYAKQSQRTKELLDERIYHL
MGELGRYGFNSDRFDRIKDFTRTVSIVPVSAKTGEGIPELLAMLAGLSQQYLKDRLIFTS
GNAKGVVLEVKEMPGLGNTIDVIIYDGILRKGDTIVLGSAEGPIVTKVRNLLMPKPLQEI
RSPEDKFLSVDEVVAAVGVKIVAPDLDNAVAGTQLYVANTPEEIEDAKNKILEELSKIKI
KTDKSGVVAKADTLGTLDALVEALKRNNIPVRIADIGNITKRDVVEASISKQDDETLGVI
LGFNVKVMPDAKEEAEKLNVKIMLNNIIYKLLEDYFNWKEEVKRLEKIKEMENLVWPAKF
RIIPGFVFRRSDPVIVGIEVLGGILKPGSPLMDEAGRKLGILQQIQDKGQSLKEAKPGMQ
VAISVKGNIMVGRQINEGDIIYTDVPDLHARTFLTKFKGDISDDVKMVLDEIIKIKRKSD
PLYAFV
Download sequence
Identical sequences I0A0D0
gi|385805491|ref|YP_005841889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]