SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805513|ref|YP_005841911.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805513|ref|YP_005841911.1|
Domain Number 1 Region: 7-86,178-353
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.21e-63
Family Bacterial dinuclear zinc exopeptidases 0.0000055
Further Details:      
 
Domain Number 2 Region: 75-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 4.27e-30
Family Aminopeptidase/glucanase lid domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385805513|ref|YP_005841911.1|
Sequence length 367
Comment metalloexopeptidase, family M42 [Fervidicoccus fontis Kam940]
Sequence
MQNFNKDEYKKCLRKYSQANGPSGMEDEVRDLLIEDLKPYADRIWIDSMGNVISLKKGVS
GKKLMIAAHMDEISLIVKYIDDNGFLRFSPVGGWSERILPATRVKVRTNKGDWIPGVIGV
KPPHLITPEEEKKVIEMNKLFIDVGASSRQEALSMGIEHGSRVLLDYDFADLIGNRVTGK
AFDDRAGLVVALKTFMEVEPNDIDLYFVATVQEEVGLKGARTSAYQISPDVAIALDVTTA
NDVPDVDEQDQVAKLGKGPAIKIIDGRSGSGLITNTAVLEKMISVAKERGIPYQAEVLTG
GTTDSSAIQLTKEGVPAGTISIPARYIHSPVEVIDLVDIHYSVELLKAFYESLKPEWIDS
IKEKIIK
Download sequence
Identical sequences I0A0F2
gi|385805513|ref|YP_005841911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]