SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805536|ref|YP_005841934.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805536|ref|YP_005841934.1|
Domain Number 1 Region: 35-88
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.41e-16
Family Pseudouridine synthase II TruB 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805536|ref|YP_005841934.1|
Sequence length 108
Comment H/ACA RNA-protein complex component Cbf5p [Fervidicoccus fontis Kam940]
Sequence
MKTADVINEIENRISEFCGKSEWWNILAEEIVEIEGKASNPFERDINSLIERGIIVIDKP
PGPTSHEVVAWVKRMLGVKKVGHGGTLEGLLDGDPGETPKSQVSCLLD
Download sequence
Identical sequences I0A0H5
gi|385805536|ref|YP_005841934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]