SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805561|ref|YP_005841959.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805561|ref|YP_005841959.1|
Domain Number 1 Region: 296-413
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000303
Family Integrin A (or I) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805561|ref|YP_005841959.1|
Sequence length 435
Comment hypothetical protein FFONT_0517 [Fervidicoccus fontis Kam940]
Sequence
MLSDEINLDEVISIVQGIAGRLRERNVLVSTSEIENAVKLYITATQLSPYGYFPLKPVIE
SVFVKRKYDEEIFNDAWRDISKVSYGEKIRASEKPKEKLLKGKRIEEKEEHESLDIARMQ
KLSVGKLRKMGKFNEENKRKLEIARKINTLQKYYETGNRGYIDLLESELKASQKKKGSYE
SKDSYSASSRYEAIEKLLFRIVENPDNANALLALSKITGSDLPIEAIKYFVKKRKTFLVE
KIAASIFKRSGGLLKGKKYEKGYIYGRVDIRKTLFELSRNHPEELVFKQKKRENGAILVI
DKSDSMRKRSTSVIKIASQYYPFLKSLILFDTEVKVKKISRSSSRWNIVKDLLSMNFSGY
TNISKALRQVIEISKPKDTVIIISDMEQTVEDEFYISLIDKLIRKKVRLIIFTSEEYAKI
FKQIFPSSVNVKLIL
Download sequence
Identical sequences I0A0K0
gi|385805561|ref|YP_005841959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]