SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805637|ref|YP_005842035.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805637|ref|YP_005842035.1|
Domain Number 1 Region: 6-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.17e-76
Family G proteins 0.0000000591
Further Details:      
 
Domain Number 2 Region: 329-433
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.22e-37
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000428
Further Details:      
 
Domain Number 3 Region: 230-326
Classification Level Classification E-value
Superfamily Translation proteins 1.19e-27
Family Elongation factors 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385805637|ref|YP_005842035.1|
Sequence length 441
Comment elongation factor 1-alpha [Fervidicoccus fontis Kam940]
Sequence
MRVIPMSEKPHLNLVVIGHVDHGKSTTVGHILYRLGYVDPKKLAELEEEAKKKGKESFKY
AWLLDNLKEERERGVTIDLSFMKFETKKYYFTIIDAPGHRDFVKNMITGASQADAAILVV
SARKGEFEAGMSPEGQTREHLILAKTMGIEQIIVAVNKMDATEPPYSQERYKQVIDTLQK
FMKGLGFDISKIPFIPISGWNGDNLIERSPAMPWYNGPTLVEALDNIQIPPKPIDKPLRI
PIQAVYAISGIGTVPVGRVESGVLKKGDRIVFMPPAIVGEVRSIEMHHTQIEKAEPGDNI
GFNVRGVTKTDIKRGDVAGHLTNPPTIAKEFTARLFIIWHPSAVTVGYTPVIHAHTASIA
AKITELVSKLDPRTGKEAEKNPQFLKQGDTAIVKFQPIKQMVVEKFSEFPALGRFAMRDM
GKTIGIGVITDVVPEQVQIKG
Download sequence
Identical sequences I0A0S6
gi|385805637|ref|YP_005842035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]