SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805659|ref|YP_005842057.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805659|ref|YP_005842057.1|
Domain Number 1 Region: 7-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.46e-33
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385805659|ref|YP_005842057.1|
Sequence length 151
Comment ribosomal protein-alanine acetyltransferase RimI-like protein [Fervidicoccus fontis Kam940]
Sequence
MTAEISFSIESASMRDLKEVYEIELSSFPRYPYSISVLVSFLTLFPELFLIARHEERIVG
YIAGFMEKEDRGHIASIAVRQEYRGRGIGRKLLEEEENKMRNLDVKEVVLEVSENNEVAI
RLYTSMGYKKIKRVKNYYPDGSAAFIMKKTL
Download sequence
Identical sequences I0A0U8
gi|385805659|ref|YP_005842057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]