SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385805794|ref|YP_005842192.1| from Fervidicoccus fontis Kam940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385805794|ref|YP_005842192.1|
Domain Number 1 Region: 331-508
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.4e-51
Family DNA gyrase/MutL, second domain 0.00000264
Further Details:      
 
Domain Number 2 Region: 26-221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-29
Family DNA gyrase/MutL, N-terminal domain 0.00000327
Further Details:      
 
Domain Number 3 Region: 255-327
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.000000000000037
Family Topoisomerase VI-B subunit middle domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385805794|ref|YP_005842192.1|
Sequence length 561
Comment DNA topoisomerase VI subunit B [Fervidicoccus fontis Kam940]
Sequence
MVRDISAVDTMTENVESFRQLSPSEFFYRNKEIAGFSSPSRALYQTVREFVENSLDATEV
HGILPNVVISISREDSSNPNYFTVSVEDNGIGIPSNIIPDAFGRILYSSKYKFRQTRGMY
GLGAKMAILYGQITTGKPFEIYSSTSRSNKIFYYKLSVDIRKNEPIVFEEGAWEKKTSWH
GTIAKVTIEGDWNKRTRDYISVYVKRTAIIAPYADITLIMPKFNGEQEGNGEEESEIVCY
KRVTDKLPVPPKETKPHPLGIDLEMLKMSISESKNKTIKDFLMKNFQRIGEKKAEEILKI
AGIDFDRNPKNLNDKEIEALYKSIKSVDFISPSPDPLSPIGEELIKIGLKQVLNPEFVDA
ITRKPKSYGGHPFIVEAGIAYGGKLSENLDEIARDSIKGQSGPFIALLRYANKIPLLYDE
KADLIWSVVNPDDFNWKNTYKLDPSDIVVVLVHIASTKVPYKGVGKESIAQVEEIRKEVE
AAVQELARRLRKYIVKKRKREEAEEKFRIFLKYIPEVAQNLAVFYDGVSPEERKKIAQEL
ESTLKAIAEKKVKIIEEVKEE
Download sequence
Identical sequences I0A183
gi|385805794|ref|YP_005842192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]